KEGG   Yokenella regensburgei: HEC60_20705
Entry
HEC60_20705       CDS       T06519                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase iron sulfur-binding subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
yre  Yokenella regensburgei
Pathway
yre00230  Purine metabolism
yre01100  Metabolic pathways
yre01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:yre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HEC60_20705 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 DUF1704
Other DBs
NCBI-ProteinID: QIU91556
UniProt: A0A6H0KGN9
Position
complement(4297607..4298083)
AA seq 158 aa
MNHESWVTVACTINGSAQQFTLSPATPLSTLLRSHGLLSIKQGCSVGECGACTVLIDGVA
IDSCLHLASWVDGKSISTLEGESVGGEISKIQQAYAKSGSVQCGFCTPGLVMATKALLAK
PHQKPFTVQEIRRGLAGNLCRCTGYQMIVDTVRTCEQE
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaatcacgaatcctgggtaaccgtcgcctgtacgattaacggctccgcgcagcagttt
acgctgtcaccggcaacgccgctctccaccctgctgcgttctcacgggttgctcagcatc
aagcagggttgcagcgtgggcgaatgtggggcctgcaccgtgctgattgacggcgtggcg
atagacagctgcctgcatcttgccagctgggtagacggcaaaagcatcagcacgctggaa
ggagaatcggtcgggggcgagatctcaaagatccagcaggcctacgcgaaatcaggatcg
gtgcagtgcgggttctgtacgcctggactggtcatggcgaccaaagcgctactggcaaaa
ccgcatcagaaaccctttacggtgcaggagatccgccgtggtctcgccggaaatctgtgc
cgctgtacgggatatcagatgattgtcgatacggttcgcacctgcgaacaggagtaa

DBGET integrated database retrieval system