KEGG   Yersinia rohdei: CH64_1212Help
Entry
CH64_1212         CDS       T03610                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
yro  Yersinia rohdei
Pathway
yro00430  Taurine and hypotaurine metabolism
yro00620  Pyruvate metabolism
yro00640  Propanoate metabolism
yro00680  Methane metabolism
yro01100  Metabolic pathways
yro01120  Microbial metabolism in diverse environments
yro01200  Carbon metabolism
Module
yro_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH64_1212 (ackA)
   00640 Propanoate metabolism
    CH64_1212 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    CH64_1212 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CH64_1212 (ackA)
Enzymes [BR:yro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CH64_1212 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AJJ10845
UniProt: A0A0U1HVT5
Position
1351355..1352557
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDATNGEEHLSGLAECFHLPEARLKWKMDGGKHEAALGAG
AAHSEALKFIVNTILAQKPELSAQLTAIGHRIVHGGEKFTASAIVTEEVIQGIKDSIPFA
PLHNPAHLIGIAEALKSFPNLADKNVAVFDTAFHQTMPEESYLYALPYNLYKEHGIRRYG
AHGTSHFYVSQEAAKTLNKPLEELNVITCHLGNGGSVTAVRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDAMGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYDTKADAR
RAMDVFCHRLAKYIGAYTALMDGRLDAVVFTGGIGENAAMVRELTLDKLGLLGFEIDHER
NLAARFGKSGTITKDGSRLALVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagctagtactggttcttaactgcggtagctcttccctgaaattcgctatc
atcgacgcaaccaatggtgaagaacacctctctggtttagccgaatgcttccacctgcca
gaggcacgcctcaaatggaaaatggatggcggtaaacacgaagccgcattgggtgctggt
gccgcacacagcgaagcactgaaattcattgttaatactattctggcacaaaaaccagag
ctatctgctcaactgacagctattggtcaccgtattgttcatggtggcgagaaattcact
gcgtcagctatcgttaccgaagaagttattcagggtatcaaagattccatcccgtttgca
ccactgcataaccctgctcacctgatcggtattgctgaggcattgaaatccttcccgaat
ctggctgataaaaatgtcgccgtctttgacacggccttccatcagaccatgccggaagag
tcttacctttacgccctgccgtacaatttatacaaagagcacggtatccgtcgctatggc
gcgcacggcaccagccacttctacgtgagccaggaagccgctaaaacgctgaacaaacca
ctggaagagctgaacgtaatcacttgccatctgggcaatggtggttctgtcactgcagtt
cgtaacggtaaatgtgttgatacttctatgggcctgacaccactggaaggtctggtcatg
ggcacccgtagtggtgatattgacccggcaatcattttccatctgcatgatgcaatgggg
atgagtgttgatcaaatcaacaaaatgttgaccaaagaatctggcctgttaggtctgact
gaagtcaccagtgactgccgttatgttgaagacaactatgacaccaaagcagatgcacgc
cgcgcaatggatgtgttctgtcaccgcctggctaaatacatcggtgcttatactgcattg
atggatggccgtctggatgcagttgtattcactggcggtattggtgaaaacgccgcaatg
gtacgcgaattaaccttggacaaactgggcctgctaggttttgaaattgaccacgaacgc
aacctggcagcacgctttggcaagtctggcaccatcaccaaagatggcagccgcctggct
ctggttatcccgaccaatgaagaattggtcatcgcgcaagacgcctctcgtcttaccgcg
taa

DBGET integrated database retrieval system