KEGG   Yersinia rohdei: CH64_2406Help
Entry
CH64_2406         CDS       T03610                                 

Gene name
ompR
Definition
(GenBank) transcriptional regulatory protein ompR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
yro  Yersinia rohdei
Pathway
yro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:yro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CH64_2406 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:yro02022]
    CH64_2406 (ompR)
Two-component system [BR:yro02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CH64_2406 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AJJ10280
UniProt: A0A0U1HQC7
Position
complement(2657795..2658514)
Genome map
AA seq 239 aa AA seqDB search
MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaatcacaagattctggtcgttgatgacgatatgcgcctgcgtgcgctgttg
gaacgttacctaacagagcaaggtttccaggtgcgcagtgtcgccaatgctgaacaaatg
gatcgcttgctaacccgtgagtctttccatttgatggtgctcgacctgatgttaccgggc
gaagatggcctgtctatctgccgccgcctgcgcagccaaagcaaccccatgccgatcatt
atggtgacggcgaagggcgaagaagttgaccgtatcgtcgggctggaaattggtgcggat
gattatattcctaagccatttaatccccgcgaattactggcacgtatccgcgcagtgctg
cgccgtcaggcgaacgaattaccgggcgcgccttctcaagaagaagctgtgattgccttt
ggcaagttcaaactgaatcttggtactcgcgagatgttccgtgaagacgaacctatgcca
ctgaccagtggtgaatttgcggtgctgaaagccttggttagccacccgcgtgagccgcta
tcccgcgataaactcatgaatctggcacggggccgcgaatacagcgccatggaacgttcg
attgatgtgcagatttcacgtctgcgccgcatggtagaagaagatccagctcacccgcgc
tatatccaaaccgtttggggcttgggttacgtctttgtgccggacggcagtaaagcatga

DBGET integrated database retrieval system