KEGG   Yersinia rohdei: CH64_3176Help
Entry
CH64_3176         CDS       T03610                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase family protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
yro  Yersinia rohdei
Pathway
yro00052  Galactose metabolism
yro00500  Starch and sucrose metabolism
yro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CH64_3176
   00500 Starch and sucrose metabolism
    CH64_3176
Enzymes [BR:yro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CH64_3176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AJJ12349
Position
complement(3552351..3553760)
Genome map
AA seq 469 aa AA seqDB search
MLEASLLKHLTLAVMRGQCRASQDPHRPGWHLAPCVGLLNDPNGFIYHAGYYHLFYQWNP
LDCRHGSKFWGHWCSTDLVHWEHQPVALVPSEAYESHGCYSGSAVIADDLITLIYTGNVK
YPDGSRTAFQCLAQENPRGEFDKLGPVLSLPTGYTGHVRDPKVWQHHGQWYMVLGAQDLQ
LQGKVLLLRSDNLREWHNLGEIAGSHLGGLGPFGYMWECPDLFRLAEQDVLIFCPQGIAA
ESERYRNTFQAGYLLGQLDYANASYSHQDFHELDAGFEFYAPQTTVAADGRRLLFGWMGI
PDDDEFYQPTVAYGWIHTMTCPRELSMQGNQLIQQPARELTALRREYRQWQGPAQEAPYL
PINSAEMIIDVNAPFSLELGHTLHLAWDGERITLSRNNLRTGLREFRYWRGQLHQLQLLC
DRCSIEIFINQGEAVMTSSYFPPDLPRAIFSGSAELHLQHWLLSSPMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagccagtttacttaaacatctgacactggcagtgatgcgcggtcagtgccgc
gcatcgcaagacccacaccggccgggttggcatctggcaccttgtgttgggttgctgaat
gatcccaatgggtttatttatcatgctggctattaccatcttttctatcaatggaaccca
ttggattgccgccacggcagtaaattctggggccactggtgcagtacagatttggtgcat
tgggaacatcaacccgtggcattggttcccagcgaagcatacgaaagtcatggttgttat
tccggttccgccgtcattgctgatgaccttatcaccctgatttataccggaaatgtgaaa
tatcccgatggctctcgcacagcatttcaatgtttggcccaagagaatccacgcggtgaa
tttgacaaactggggccggtattatctttgcccaccggctataccggccacgtccgtgac
ccaaaagtttggcaacatcatggccagtggtacatggtgttaggcgcacaagacctgcaa
ctgcaaggtaaagttctgctgctgcgctctgataatttacgcgaatggcacaatcttggt
gagattgcgggctcccatcttgggggccttgggccttttggttatatgtgggaatgccca
gatttattcaggttagccgagcaggatgtgttgattttctgcccgcaaggtattgcggcg
gaatcggaacgttatcgaaatacctttcaggcgggttatttactgggccaattggattat
gccaacgccagctacagccatcaggatttccacgagttggatgcgggatttgaattctac
gcgccacaaaccacagtggctgccgatggtcgccgcctgttattcggttggatggggata
ccggatgacgatgaattttatcagccgacggtagcctatggctggatccacaccatgacc
tgcccgcgcgagttgagcatgcagggtaaccagctgattcagcaacccgctcgtgaatta
actgccctgcggcgcgaatatcgccagtggcaaggccctgctcaagaggcaccctatctc
cctataaacagtgccgaaatgataattgacgtgaatgcgcctttttccctcgaattgggc
cacacgctgcatttggcatgggatggcgagcgcatcactttgagccgcaataatctgcgc
accggattgcgggagtttcgttactggcgcggccaattgcaccaattacagctgctttgt
gacaggtgcagtatagaaatctttattaatcagggagaagccgtgatgacctcgagctac
ttcccgccagatttaccacgggcaatattcagcggaagtgccgaactgcatctgcaacac
tggctgttgtcttcgcccatgttagaatga

DBGET integrated database retrieval system