KEGG   Yersinia rohdei: CH64_3249Help
Entry
CH64_3249         CDS       T03610                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
yro  Yersinia rohdei
Brite
KEGG Orthology (KO) [BR:yro00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CH64_3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AJJ09671
UniProt: A0A0U1HXM0
Position
complement(3638127..3638504)
Genome map
AA seq 125 aa AA seqDB search
MIEQPRVCVQVQSIYVETQSIPDEERFVFAYTVTIRNLGRSNVQLMGRYWLITNSNGRQT
EVQGEGVIGEQPLILPGNEFQYTSGAVLETPLGTMEGHYEMVDHLGQAFRTAIPVFRLAI
PALIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacagccccgcgtttgtgtacaggtacaaagtatctatgtggaaacccagtcg
atacccgacgaagaacgtttcgtctttgcctataccgtgacgattcgtaatttgggccgt
tcaaatgtgcaactgatgggccgctattggttaattactaatagtaatggccggcagact
gaagttcagggcgaaggagtcatcggtgagcagccgttgattctgccaggtaatgagttc
caatacaccagtggcgctgtattagaaaccccgctgggtaccatggaagggcattatgag
atggttgatcaccttggtcaggctttccgtactgcaattccggtgttccgtttagcgatc
cccgcacttatccattaa

DBGET integrated database retrieval system