KEGG   Yersinia rohdei: CH64_3495Help
Entry
CH64_3495         CDS       T03610                                 

Gene name
mtnB
Definition
(GenBank) methylthioribulose-1-phosphate dehydratase
  KO
K08964  methylthioribulose-1-phosphate dehydratase [EC:4.2.1.109]
Organism
yro  Yersinia rohdei
Pathway
yro00270  Cysteine and methionine metabolism
yro01100  Metabolic pathways
Module
yro_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:yro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CH64_3495 (mtnB)
Enzymes [BR:yro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.109  methylthioribulose 1-phosphate dehydratase
     CH64_3495 (mtnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AJJ12177
Position
3932397..3933014
Genome map
AA seq 205 aa AA seqDB search
MTENEQLGALLAACHWIGEKGWCPATGGNMSLRLDATQCLVTESGKDKGSLTADDFLLVE
TANNHVPSGRTPSAETGLHTLLYRRYPEINAVLHTHSVNATVLSRVERSNELVLQGYEMQ
KSLAGQRSHLDSVIIPIFDNDQDIPALAQRVAALADHSPLRYGFLVRGHGLYCWGNSVSE
ARRHLEGLEFLFQCELQRRLFNVIP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaatgaacaactcggcgcgctgctcgccgcctgccactggatcggcgagaag
ggctggtgcccggcgaccggcggcaatatgtccctgcggctggacgcaacacaatgttta
gtgaccgaatctggcaaagataaaggcagcttgaccgcagatgactttctgctggtggaa
acggccaataaccatgtgcccagcggtcgcacaccttcggcagaaaccggcctgcatact
ttgctttatcgccgataccctgaaatcaatgcggtcttacatactcactcggtgaatgcc
actgtgctatcgcgggtcgagcgcagcaatgaattagtattgcagggctatgagatgcaa
aaatcgctagcagggcagcgcagccatcttgactcagtcattattcctatttttgataat
gatcaggatattcctgccctggcgcagcgagtggcagcactggcagaccatagcccgcta
cgttatggctttttagtgcgcggccacggtttgtattgctggggcaatagcgtgtctgaa
gcccgccgccatttggaaggattggaattcttattccagtgtgaactgcaacggcgttta
tttaacgtaatcccttaa

DBGET integrated database retrieval system