KEGG   Yersinia rohdei: CH64_855Help
Entry
CH64_855          CDS       T03610                                 

Definition
(GenBank) ubiE/COQ5 methyltransferase family protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
yro  Yersinia rohdei
Brite
KEGG Orthology (KO) [BR:yro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:yro03009]
    CH64_855
Enzymes [BR:yro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CH64_855
Ribosome biogenesis [BR:yro03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CH64_855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Ubie_methyltran Methyltransf_32 Methyltransf_12 MTS PCMT RrnaAD Methyltransf_9 FtsJ
Motif
Other DBs
NCBI-ProteinID: AJJ10975
UniProt: A0A0U1HMB0
Position
complement(935592..936464)
Genome map
AA seq 290 aa AA seqDB search
MSYQCPLCHQALQQSQQQWRCCNNHQFDCAKEGYVNLMPVQHKGSKQPGDSPEMMQARRA
FLDAGCYQPLQQRVCEILDKALPLDAAMLLDIGCGEGYYTAAVAERLNRQRQVCVFGLDV
AKVAVRYGAKRYPQVNFCVASSHRLPFNNQSLDAVLRIYAPCKAAELARTVKPGGIVVTV
VPGPRHLYQLKALIYAQVQLHDDAQEHLDGFELVSSERLAYEMKLTGKQGVNLLQMTPFA
WRASIEVGQELATRQTFVCETDFVIALHRRKADSTIDSNRLESDEEHICA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcagtgccccctttgtcatcaggccttgcagcaaagccagcaacagtggcgt
tgttgtaataatcaccagtttgattgcgccaaagagggttatgtcaatttgatgccggtg
caacataagggatcaaaacaaccgggggatagccccgagatgatgcaggcccgccgggcg
tttcttgatgcgggttgttatcagcctttgcagcagcgcgtttgtgagattctggataag
gcgcttcctctggatgccgcgatgttgcttgatattgggtgtggcgaaggctattacact
gccgccgtggcagaacggctaaatcgccagcgtcaggtttgcgtgtttggtttagatgtt
gccaaagtggcggtaagatatggtgcaaaacgctatcctcaggtgaatttttgtgtggcc
tccagtcaccgattaccgtttaacaatcagtctcttgatgctgtcttgcgtatttatgca
ccttgcaaggctgctgaattagctcgcacggtaaaacccggcggaatagtggttaccgtg
gtgcccggcccacgtcatctgtaccaattaaaagccctgatttatgcccaagtacaactc
catgatgatgcacaagagcatctggacgggtttgaattagtcagtagtgaacgattggct
tatgaaatgaaattgaccggcaagcaaggcgttaacttattgcaaatgacgccgtttgcc
tggcgcgcctctattgaggtcgggcaagagttggctacacgacagacatttgtctgtgaa
acagattttgttattgctttgcatcgtcgcaaagctgattccactattgacagtaataga
ctagagagtgacgaagaacatatatgtgcttag

DBGET integrated database retrieval system