KEGG   Yersinia ruckeri YRB: BD65_1948Help
Entry
BD65_1948         CDS       T03611                                 

Gene name
yihX
Definition
(GenBank) phosphatase yihX
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00010  Glycolysis / Gluconeogenesis
yru01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BD65_1948 (yihX)
Enzymes [BR:yru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     BD65_1948 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase SHOCT HAD Hydrolase_like PNK3P
Motif
Other DBs
NCBI-ProteinID: AJI94834
Position
complement(2122340..2122927)
Genome map
AA seq 195 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSNLSSIPLATLTERFSMGEIFQQHERGEVSDEEFARQ
FSDEMGLSLSFEQFALGWQAIFVGLRPEVIAVMNKLREEGHRVVVLSNTNRLHCNYWPQH
YPEVAAAVDQMYLSQDLGMRKPDAEIYHHVLNHENFPPEQAVFFDDVAANIESAAALGIN
VVHVTDKTVIPAYFS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatctagggaatgtgattgttgatatcgacttcaaacgcgtattg
ggtgtctggagcaatctgagcagtattccgctggcgactttgactgaacgtttttccatg
ggagaaatatttcagcagcatgagcggggtgaagtcagcgatgaggaattcgcacgccaa
ttcagtgatgaaatggggctatccttgagttttgagcaatttgctctcggctggcaagcc
atttttgtcggcttacgccctgaagtgatcgctgtcatgaataaattgcgggaggaaggt
catcgggtggtagtgctctccaatactaatcggctgcattgcaattactggcctcaacat
tacccagaagtcgccgctgcggtcgatcagatgtatttatcgcaggatttggggatgcgt
aaaccagatgctgagatttatcatcatgttttaaatcatgaaaacttcccacctgagcag
gcggttttctttgatgatgtagccgccaacattgaatcggcagcagcgttaggtattaat
gtggtacatgtaactgacaaaaccgttattccagcctatttttcctaa

DBGET integrated database retrieval system