KEGG   Yersinia ruckeri YRB: BD65_2043Help
Entry
BD65_2043         CDS       T03611                                 

Definition
(GenBank) mannitol dehydrogenase Rossmann domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00051  Fructose and mannose metabolism
yru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BD65_2043
Enzymes [BR:yru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BD65_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N ApbA NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AJI95760
Position
2234586..2235749
Genome map
AA seq 387 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGAEVIFADVNQPLLDELNRRKCYQVNVVGEQARTEAV
NNVSAVHSGSEDVVTLIADVDIITTAVGPQVLARIADRVAQGLVARHQKGNNQPLNIIAC
ENMVRGTSQLKQHVFAVLPDNEKGWVEDHVGFVDSAVDRIVPPSAAGSTDLLAVTVETFS
EWIVDQTQFKGQLPKIAGMELTDNLMAFVERKLFTLNTGHAVTAYLGQLSGHQTIRDAIL
DPQVRQVVKGTMEESGAVLIKRYGFDPQKHAAYINKILSRFENPYLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYQLPHDNLVKGIAAAMSYRSQQDPQAQEWVELLDTVGPKVALAQ
VSSLLVNSEVVEQVVSVYNAMQENLMH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggtgcaggtaacattggtcgcggtttcattggcaaattactg
gctgatgcgggtgctgaagtgattttcgccgacgtcaatcaaccgttactggatgagttg
aatcgtcgcaagtgttatcaggttaatgtggtcggcgagcaagcgcgtacggaagcagtt
aataacgtgagtgcagtgcatagcggcagcgaggacgtggtcacgctgattgctgatgtc
gatattattaccactgcggttgggccacaggtgttggccagaatagctgatcgtgtagcg
caagggttggtcgctcgccatcagaagggaaataatcagccactgaatattattgcctgt
gaaaatatggtgcgtggcaccagccagctaaaacagcatgttttcgccgtgctgccggac
aatgaaaaaggctgggttgaagatcacgtcgggtttgtcgattccgccgtcgatcgtatt
gtgccgccgtcagcggcaggcagcaccgacctgttggccgtgacggttgaaacctttagc
gagtggattgtcgatcaaactcagtttaagggtcagctaccgaaaattgccggtatggaa
ctgactgataacctgatggcttttgttgaacgtaaactatttacgctgaataccggtcat
gccgttaccgcttatcttggccagttatcaggccaccaaaccattcgcgacgctattctc
gatccacaggtacgccaggttgttaaagggacgatggaagaaagtggggcggtgctgatt
aagcgctatggctttgatccacagaaacatgcggcttatatcaacaaaattttatctcgc
ttcgaaaacccatacttgcatgatgatgttgagcgggtggggcgtcagccgctacgtaaa
ctcagcgctggcgatcgactgataaagccgctgctaggcacactggaatatcagttacct
cacgacaatttggtgaaaggtattgccgccgcgatgagttatcgtagccagcaagatcct
caggcgcaggaatgggttgaattactcgacacagtcggtccgaaagtggcattggctcaa
gtttcttcattgttggtcaatagcgaggttgtcgaacaggtggtgagtgtgtataacgcc
atgcaggaaaacctgatgcactaa

DBGET integrated database retrieval system