KEGG   Yersinia ruckeri YRB: BD65_2482Help
Entry
BD65_2482         CDS       T03611                                 

Gene name
nadR
Definition
(GenBank) trifunctional NAD biosynthesis/regulator protein NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00760  Nicotinate and nicotinamide metabolism
yru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BD65_2482 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:yru03000]
    BD65_2482 (nadR)
Enzymes [BR:yru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     BD65_2482 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     BD65_2482 (nadR)
Transcription factors [BR:yru03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    BD65_2482 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 HTH_26 CTP_transf_like Citrate_ly_lig MMR_HSR1 HTH_37 FAD_syn ABC_tran AAA_16 AAA_29 HTH_35 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AJI94693
Position
2718279..2719568
Genome map
AA seq 429 aa AA seqDB search
MLQFDYLKMAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPSAQKLEALHRFLGLEFP
RREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHIILCHDEPRDRELFESSSMSQQPTV
SDRLRWLLQTFKYQKNIRIHSFDEHGIEPYPHGWDVWSHGVKEFMANKGIVPSFIYSGDS
QDAPRYREQLGIETILIDPQRSFMEISGRQIRRDPFRYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYVDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSTERKSFQNLLEEMLQANNVEYVHVESADYDERFLRCVELVQQLLAADSLRVSRTSYTE
DELKISLME
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagttcgattatttaaaaatggccattaagcaaaaaggctgcacgctacaacaa
gtggctgaagccagcgggatgactaaaggttatttaagccaacttctcaacgacaaaatc
aaaagccccagtgcgcaaaaacttgaagctttgcaccgttttctcgggttagagtttcct
cgccgtgagaaaaaggtcggcgtggtgtttggtaaattttaccctctgcataccggccac
atctatttgattcagcgcgcctgtagccaagtagacgaactgcatatcattctttgccac
gatgagccgcgggatcgggaactgttcgagagcagctcgatgtcacagcagccaacggtc
agtgaccgtttacgctggttgttgcaaaccttcaaatatcagaaaaatattcgcattcat
tcttttgatgagcacggaatcgagccttatccgcacggttgggatgtctggagtcacggc
gtcaaagaatttatggcaaataaaggcatagtgccgagctttatctattctggcgacagt
caggatgcgcctcgttaccgcgaacagctcggtatcgaaacaattttaatcgatccacaa
cgctcatttatggagatcagtggccgtcaaatccgccgtgatcctttccgttattgggac
tatatcccaacggaagtgaagccgtttttcgtacgtacggtggctattctgggaggcgaa
tccagcgggaaatcgacgttggtcaacaagttggccaacattttcaataccaccagcgcc
tgggaatacgggcgggattatgtcttttcccatttaggtggcgacgagatggcgctgcaa
tattccgattacgacaaaatcgcgctgggacaggctcaatacgtcgattttgcggttaaa
tatgccaataaagtggcctttatcgatactgattttgtcaccactcaggcgttctgcaag
aaatatgaagggcgagagcatccctttgtacaggcgctgattgatgagtatcgtttcgat
ctggttattttgctggaaaacaataccccgtgggtggctgatggcctacgcagcctaggc
agtagcactgagcgaaaatccttccaaaatctgctggaagagatgctacaggctaataat
gtcgagtatgtgcatgtggaatcagcggattatgatgagcgcttcctgcgctgcgtcgag
ttggtgcagcaattgttggctgccgactcattgcgtgtatctcgaacatcgtacactgag
gacgagttaaaaatcagcctgatggaatga

DBGET integrated database retrieval system