KEGG   Yersinia ruckeri YRB: BD65_3212Help
Entry
BD65_3212         CDS       T03611                                 

Gene name
ltaE
Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00260  Glycine, serine and threonine metabolism
yru01100  Metabolic pathways
yru01110  Biosynthesis of secondary metabolites
yru01120  Microbial metabolism in diverse environments
yru01130  Biosynthesis of antibiotics
yru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:yru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BD65_3212 (ltaE)
Enzymes [BR:yru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BD65_3212 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJI94883
Position
complement(3531048..3532064)
Genome map
AA seq 338 aa AA seqDB search
MFIDLRSDTVTRPCTAMREAMANAEVGDDVYGDDPTVNTLEAEGAKLSGKAAALFLPSGT
QANLVALLSHCQRGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGSLPLDKVLAA
IKPDDIHFAQTRLLSLENTHSGKVLPISYLQQAWELTREHQLALHIDGARIMNAAVALNL
PLREITQYCDTLTICLSKGLGAPVGSLLCGSADYIKRARRWRKMTGGGMRQAGILAAAGL
FALQNNVARLQQDHDNALWLERQLQQLGVEIIAPGAQTNVLYIRQSVELAAQMGAWMRER
GVLISAGPVTRMITHLNVSRADLERVVSLWREFLATHN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgatctacgcagtgacacagtaactcgcccttgcaccgctatgcgtgaagcg
atggccaatgccgaagttggcgatgacgtttatggcgatgacccgacggtcaacacgttg
gaagccgaaggagcaaagctgtctggtaaagccgccgcactgttcttacccagtggtact
caggctaatctggtggcattactgagccactgtcagcgtggcgaagaatatattgttggg
cagaaagcccataattatctgtatgaagctggcggtgccgctgtgctcggcagtattcag
ccacagccgattgatgctaatgatgacggcagcctgccgctggataaagtcctggccgcc
attaaaccggatgatattcattttgcacaaacgcgcctgctcagcttggaaaatacccac
agtggtaaagtcctaccgataagctacctgcaacaagcgtgggaattgacccgtgaacac
cagttggcgctgcatattgatggcgcgcggattatgaatgcggcagtggcgctgaatctg
ccactgcgggaaataacccaatattgcgatacactgaccatctgtctttccaaagggtta
ggagcgccggtgggttcactcctatgcgggagtgcagactatatcaaacgcgcacgccgt
tggcgcaaaatgaccggcggtggcatgcgtcaggccggtattctggcggcagctggtctg
tttgcactacagaacaatgtagcccgattgcagcaagaccatgataatgcgctatggctg
gaacgccaactgcagcaattgggtgtagaaattattgcaccgggtgcgcaaaccaatgtg
ctgtatatccgccagtcggttgaactcgcagcccaaatgggggcgtggatgcgtgaacgc
ggcgtgctaatcagcgccggacctgttacccgaatgataactcacctgaatgtcagccgt
gccgatctggagcgagttgtcagcctgtggcgcgagtttcttgctacacataactga

DBGET integrated database retrieval system