KEGG   Yersinia similis: BF17_02210Help
Entry
BF17_02210        CDS       T03057                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ysi  Yersinia similis
Pathway
ysi00260  Glycine, serine and threonine metabolism
ysi00630  Glyoxylate and dicarboxylate metabolism
ysi00670  One carbon pool by folate
ysi01100  Metabolic pathways
ysi01110  Biosynthesis of secondary metabolites
ysi01130  Biosynthesis of antibiotics
ysi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BF17_02210 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BF17_02210 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BF17_02210 (gcvT)
Enzymes [BR:ysi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     BF17_02210 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AHK18309
UniProt: A0A0T9RDP5
Position
complement(395641..396738)
Genome map
AA seq 365 aa AA seqDB search
MAKQTPLYDQHVACGARMVDFHGWMMPLHYGSQIDEHHLVRQDAGMFDVSHMTIVDLHGS
RTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFLSEDYFRLVVNSATRDK
DLAWIIQHAEPYQVEVTVRDDLALVAVQGPQAQQKVATLLTTEQQQAVAGMKPFFGIQTG
DLFIATTGYTGEAGYEIALPKQQVVAFWQQLLAAGVKPAGLGARDTLRLEAGMNLYGQEM
DERTSPLAANMGWTVAWQPEDRQFIGRTALERQRAKGTEQLVGLIMTEKGVLRNELPVYF
FDAAGNQHVGVITSGSFSPTLGFSIALARVPAGIGEHAVVQIRNREMPVRVTKPGFVRAG
KAIVL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcagaccccgctgtatgaccaacatgtcgcgtgcggtgcgcgtatggtagat
tttcatggttggatgatgccattgcattatggctcccaaattgacgaacaccatcttgtg
cggcaggatgcaggcatgtttgatgtctcccacatgaccatcgttgatttgcacggtagc
cgtacccgtgagtttttgcgctatctgttggctaacgatgtagccaaactgacccaaccg
ggcaaagccctttacaccgggatgctgaatgaatccggcggtgttatcgatgatttgatt
gtttacttcctcagcgaagattatttccgtttagtggttaactccgctacccgtgataaa
gacctggcttggataattcagcatgctgaaccttatcaggtcgaggtcactgtgcgtgac
gatctggcgctggttgcagtgcaaggcccacaagcccaacagaaagtggccacgttactg
actaccgaacagcaacaagctgttgcaggcatgaagccattctttggtattcaaaccggc
gatttatttattgctaccacgggttataccggtgaagccgggtatgaaattgcgttaccg
aaacagcaggtcgtcgcgttctggcagcaactgctggccgccggtgtgaagcccgcaggc
cttggtgcgcgtgatacgctgcgcttagaagcagggatgaacttatatggtcaggaaatg
gatgaaagaacgtctccgttagccgccaatatggggtggaccgtggcctggcaaccagaa
gatcgccagtttattggccgtactgcgttggaaaggcagcgagctaaagggactgagcaa
ctagtcggtctgatcatgacggaaaaaggcgtgttacgtaatgaattaccggtgtatttt
tttgatgccgcaggcaatcagcatgttggggtgataaccagcggttcattttcgccaacc
ctgggtttcagtattgcgctagcccgtgtacccgcaggtatcggtgaacatgctgtggta
caaatccgtaaccgtgaaatgccggtacgggtaacaaaacccggttttgtgcgagcgggc
aaagccatcgtattgtaa

DBGET integrated database retrieval system