KEGG   Yersinia similis: BF17_19495Help
Entry
BF17_19495        CDS       T03057                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ysi  Yersinia similis
Pathway
ysi00450  Selenocompound metabolism
ysi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BF17_19495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ysi03016]
    BF17_19495
Enzymes [BR:ysi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BF17_19495
Transfer RNA biogenesis [BR:ysi03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BF17_19495
 Prokaryotic Type
    BF17_19495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AHK21207
UniProt: A0A0T9Q6J3
Position
4053699..4054745
Genome map
AA seq 348 aa AA seqDB search
MASPAIRLTQYSHGAGCGCKISPKVLDKILHTEQQKFFDPRLLVGNETRDDAAVYDIGNG
VGIISTTDFFMPIVDDPFDFGRIAATNAISDVYAMGGKPIMAIAILGWPIDKLAPEIAQQ
VIEGGRYVCQQAGISLAGGHSIDAPEPIFGLAVTGIVSTEQVKKNSAAKPGCKLFLTKPL
GIGILTTAEKKSKLRSEHQGLATETMCQLNKSGADFAHIPGVTAMTDVTGFGLLGHLSEI
CQGSGVQAILHYSAIPRLPAVEDYIAEGCVPGGTGRNFDSYGHLIGDMSDLQRQLLCDPQ
TSGGLLLAVLPDAETDVQAIAAQHGMILSPIGELTSTDSRRALIEIVA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgccagcgatacgtcttactcaatacagccacggggcgggctgtggttgcaaa
atttcaccaaaagttttggataaaattttgcatactgagcaacaaaagttttttgatccc
cggctgctggtgggcaatgaaacgcgtgatgatgcagcagtttatgatattggtaacggt
gttggtattatcagcaccactgatttctttatgccgatcgttgatgatccttttgatttt
ggacgaattgccgctacaaacgcgatcagcgatgtttatgctatgggggggaaacccata
atggctattgctattttagggtggcccattgacaaactggcacccgaaatcgcacagcaa
gtgatcgagggtgggcgatatgtttgccagcaagcggggatttctttggctggaggccac
tctattgatgcccctgaaccgatttttggtttggctgtcaccggaattgtcagcactgaa
caggttaagaaaaacagtgcagcaaagccagggtgtaaactgtttttgaccaagccactg
ggcattggcatcttaactacagccgaaaagaaaagtaaattacggtcagaacaccaggga
ttggcaacagaaaccatgtgtcagttgaataagtctggtgctgattttgcgcatattccc
ggtgttaccgccatgaccgatgtcacggggtttggtttgttgggccatttgagtgaaatt
tgccagggttctggtgtccaggccattctgcattactctgcgatcccacgtttacctgcc
gttgaagactatattgctgaaggctgtgttccgggggggactgggcgtaatttcgacagc
tatggccacctgatcggtgacatgtctgatttacaaagacaactactttgtgatcctcaa
acctcaggcgggttactgttggcggtattacctgatgctgaaaccgatgtccaggccatt
gccgctcagcatggaatgattctcagcccaattggtgagttaacctctacggatagtcgc
cgggcgctgattgagattgtagcgtga

DBGET integrated database retrieval system