KEGG   Yersinia similis: BF17_20170Help
Entry
BF17_20170        CDS       T03057                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ysi  Yersinia similis
Pathway
ysi00730  Thiamine metabolism
ysi00790  Folate biosynthesis
ysi01100  Metabolic pathways
ysi02020  Two-component system
Module
ysi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ysi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BF17_20170
   00790 Folate biosynthesis
    BF17_20170
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BF17_20170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ysi04147]
    BF17_20170
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ysi00537]
    BF17_20170
Enzymes [BR:ysi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BF17_20170
Exosome [BR:ysi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BF17_20170
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ysi00537]
 Enzymes
  BF17_20170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: AHK21323
Position
complement(4209703..4211130)
Genome map
AA seq 475 aa AA seqDB search
MNRVPTLSGIALSTLLLSSTLLTPNAIAAATGLYDRAAHGDVTQFGGARRLSEDQTQALR
DSLSNKTVKNVILLIGDGMGDSEITSARNYAMGAGGFFKGIDALPLTGQYTHYALDKKTQ
KPNYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKKAGKATGNVSTAELQDA
TPAAQFAHVTGRKCYGPEETSEKCSTNALEKGGRGSITEQMIDGRADVTLGGGATSFSQV
AKAGEWKDQSLRDQALARGYVIVENLDDLNAIKQANQQKPLLGLFSPGNMPVRWQGPKAS
YHGNLDKPPVVCENNAERTRDIPTLAVMTEKAIDLLKTNENGFFLQVEGASIDKQDHSAN
PCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIEPEAKAPGLTQALTTKD
GAIMAISYGNSEDDSQGHTGSQLRIAAYGPHAANVVGLTDQTDLFFTMRDAMALK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtgtacctactttatccggcatagcattatcgaccctgttactgtccagcacg
ctattgacgcctaatgctattgcggctgctactggcttatatgaccgtgcagcacatggt
gatgttactcaatttggcggcgcacgtcgtttgagtgaggaccaaacccaggctctgcgt
gactcgctgtccaataaaacagtaaaaaatgtcattttattgattggtgatgggatggga
gattccgaaatcacgtctgcccgtaactatgcgatgggggccggtggtttctttaaagga
attgatgcgctgccgctgactgggcaatacacgcactatgcacttgataaaaaaacacaa
aaaccaaactatgtgactgactctgctgcatctgcaacggcctggtcatctggcgtaaaa
acgtataatggggcgttgggagttgatgtttttggtaaagaccatgtcacgttgctggag
ctggccaaaaaagcaggcaaagcgaccggtaatgtctctaccgctgaactacaagatgcc
actcctgccgcgcagtttgcccacgttaccggtcgtaagtgctatggtccggaagaaacc
agtgagaaatgcagtactaacgcattggaaaaagggggccgtggctctattactgagcag
atgattgatgggcgtgctgatgtcacgcttggcggtggtgcgacatcattcagccaggtc
gctaaagccggtgagtggaaagaccagtcgttacgtgatcaggcgctagcccgcggctac
gtcattgttgagaaccttgatgacctgaatgcaataaaacaagctaatcaacagaaacct
ctattgggcttgttctcgccaggtaatatgcccgtgcgttggcaggggccgaaagcctcc
tatcatggcaatctggataaaccgccagtggtgtgtgaaaacaatgctgagcggacccgc
gatattccaacattggctgtcatgacggaaaaagcaattgacctgctgaaaactaatgag
aatggcttcttcttgcaagttgaaggggcttcgattgataaacaggatcactccgctaac
ccatgtggtcagtttggtgaaacggttgatctggatgaagcggtacaaaaagcgctggag
tttgcccgtgctgatggcaataccttggtgattgtgacggctgatcatgctcactccagc
cagattatcgagcctgaagctaaggcgccgggtctgactcaggcattaactaccaaagat
ggcgcgatcatggcgatcagctatggtaactctgaagacgattctcaaggccataccggg
tcacaattgcggatagcggcttatggtccccacgcggctaacgtcgtaggtttaactgac
caaactgatttgttcttcaccatgcgggatgcgatggcacttaaataa

DBGET integrated database retrieval system