KEGG   Youhaiella tibetensis: FNA67_00555Help
Entry
FNA67_00555       CDS       T06140                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
yti  Youhaiella tibetensis
Pathway
yti00010  Glycolysis / Gluconeogenesis
yti00053  Ascorbate and aldarate metabolism
yti00071  Fatty acid degradation
yti00280  Valine, leucine and isoleucine degradation
yti00310  Lysine degradation
yti00330  Arginine and proline metabolism
yti00340  Histidine metabolism
yti00380  Tryptophan metabolism
yti00410  beta-Alanine metabolism
yti00561  Glycerolipid metabolism
yti00620  Pyruvate metabolism
yti00625  Chloroalkane and chloroalkene degradation
yti00903  Limonene and pinene degradation
yti01100  Metabolic pathways
yti01110  Biosynthesis of secondary metabolites
yti01120  Microbial metabolism in diverse environments
yti01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FNA67_00555
   00053 Ascorbate and aldarate metabolism
    FNA67_00555
   00620 Pyruvate metabolism
    FNA67_00555
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FNA67_00555
   00561 Glycerolipid metabolism
    FNA67_00555
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FNA67_00555
   00310 Lysine degradation
    FNA67_00555
   00330 Arginine and proline metabolism
    FNA67_00555
   00340 Histidine metabolism
    FNA67_00555
   00380 Tryptophan metabolism
    FNA67_00555
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FNA67_00555
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FNA67_00555
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FNA67_00555
Enzymes [BR:yti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     FNA67_00555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: QEE18760
UniProt: A0A5B9DHI3
Position
complement(120396..122768)
Genome map
AA seq 790 aa AA seqDB search
MNKIAQIFETLEYGPAPESAQPALDWLKAHDGVFGHFINGAWTKPEKTFSSDNPATGESL
ALVSEGTAEDVDKAVKAARAAFKSWSALSGYERAKYLYAIARLVQKHSRLFAVLESLDNG
KPIRESRDIDIPLVARHFYHHAGWAQHRDREFPGQVPYGVCGQIIPWNFPLLMLAWKIAP
ALAAGNTVVLKPAEFTSLTALLFAEICEKAGLPKGVVNIVTGAGETGQAIVAHPDIDKIA
FTGSTEVGKAIRAATAGTGKGLSLELGGKSPYIVFEDADIDSAIEGLVDAIWFNQGQVCC
AGSRLLVQESIEERFITKLKKRMATLRVGDPLDKAIDIGALVAPVQVARVRDLVKQGAAE
GAHVYEPDMDLPAKGCFLKPALITNVSPANSVVAEEIFGPVLVAMSFRTPEEAVALANNT
KYGLAATIWSENINLALDIAPKIKAGVVWINGTNNFDAAVGFGGYKESGFGREGGKEGMG
AYMKPAWEKDLKPAPIAKAVAAKPTNPLDAAEGIDQTAKMYIGGKQARPDSGYARPVYGA
NGNLVGEVGDGNRKDIRNAVEAARAALGWGTTSAHNRAQILYYLAENLQYRRNEFAARIK
EQTGEKGEAEVDAAVERLFAFAGWADKYDGAVHNPPLRAIAAAMVEPIGVLAIVAPPSRP
LLGSVALLAPALAMGNPVVLVPSERSPLSVTDLYQVLETSDVPSGVVNIVTGESAVLART
LAEHDGVDAIWCAGDAGTSTMVEKASTGNLKQTWTSRGLYYDLADREKFEGDYFLRRATQ
VKNVWVPYGA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatcgcccaaatcttcgaaaccctcgaatacggcccggctcccgaaagcgcg
caaccggcgctcgattggctgaaggcgcacgatggtgtcttcggtcacttcatcaacggc
gcctggaccaagccggaaaaaaccttctcgtcggacaatcccgcgacgggcgagagcctg
gcgctggtgagcgaaggcacggccgaagacgtcgacaaggccgtcaaagcggcgagggcc
gcgttcaagtcatggtcggcgctctcgggctatgagcgcgccaaatacctttatgccatc
gcgcgcctcgtccagaagcattcgcgtctattcgcggtgctcgaatccctcgacaacggc
aagccgatccgcgagagccgcgatatcgacattccgctggtggcccgtcatttctaccac
catgccggctgggcccagcaccgcgaccgcgaattccccggccaggtgccttatggcgtc
tgcggccagatcataccgtggaattttccgctgctgatgctggcctggaagatcgcccca
gcgctggccgcaggcaacacggtggtgctcaagcccgccgaattcacttcgctcaccgct
ctccttttcgccgaaatctgcgagaaggcgggcctgcccaagggcgtcgtcaatatcgtc
accggcgccggtgagaccggccaggccatcgtcgcccatcccgacatcgacaagatcgcc
tttaccggctcgaccgaagtcggcaaggccatccgcgccgcaacggccggcaccggcaag
ggcctgtcgctcgagctgggcggcaagtcgccctatatcgtcttcgaggatgccgatatc
gacagcgccattgaggggctggtcgatgccatctggttcaaccagggccaggtctgctgc
gccggctcgcgcctcctcgtccaggaatcgatcgaggaacgcttcatcaccaagctcaag
aagcgcatggcgacgctgcgcgtcggcgatccgctcgacaaggccatcgacatcggcgcg
ctcgtggccccggtgcaggtggcgcgcgtgcgcgacctcgtcaagcagggcgcagccgaa
ggcgcccatgtctacgaaccggacatggacctgccggccaaggggtgctttctcaagccc
gccctcatcaccaacgtgtcgcccgccaatagcgtcgtcgccgaggagatttttgggccg
gtgctggtggccatgagtttccgcactccggaggaagcggtggcgctcgccaacaacacc
aagtatggcctcgccgccaccatctggagcgagaacatcaacctcgccctcgatatcgct
cccaagatcaaggcgggcgtggtgtggatcaacggcaccaacaacttcgacgccgccgtc
gggttcggcggttacaaggagtccggcttcggtcgcgaaggcggcaaggaaggcatgggc
gcctacatgaagcccgcctgggaaaaggatctcaagcctgctcccatcgccaaggccgtc
gccgccaagcccaccaatccgctcgacgccgcggagggcatcgaccaaacggccaagatg
tatatcgggggtaaacaggcccgtcccgatagcggctatgcccgcccggtctacggggcc
aacggcaatcttgtgggcgaggtcggcgacggcaaccgcaaggatatccgcaatgccgtg
gaagccgcacgcgcagcgctgggctggggcacgacctccgcgcacaaccgcgcgcagatc
ctctactacctggcagaaaacctgcagtatcgccgcaacgaattcgccgcgcgcatcaag
gagcagaccggcgagaagggcgaggcggaagtcgacgccgctgtcgagcgcctgttcgcc
ttcgccggctgggccgacaagtacgatggcgccgtccataacccaccgctgcgcgccatc
gcagcggccatggtcgagcccatcggcgtcctggcgattgtcgcgccccccagccgcccg
ctgctcggctcggttgccctgctggcccccgcgcttgccatgggcaatccggtcgtgctg
gtgccgagcgaacgatctccgctttcggtcaccgatctctatcaggtgctcgaaacctcg
gacgtgccttcgggcgtcgtcaatatcgtaaccggtgaaagcgccgtgctggccaggacg
ctggccgaacatgacggcgtcgacgccatctggtgcgccggcgatgctggcacctcgacc
atggtcgagaaggcttcgaccggcaatctcaagcagacctggaccagccgcggcctctat
tacgatcttgccgacagggaaaagttcgagggggattacttcctgcgccgcgccacgcag
gtcaagaacgtctgggtgccgtatggggcgtga

DBGET integrated database retrieval system