KEGG   Zhongshania aliphaticivorans: AZF00_05305Help
Entry
AZF00_05305       CDS       T04315                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00071  Fatty acid degradation
zal00072  Synthesis and degradation of ketone bodies
zal00280  Valine, leucine and isoleucine degradation
zal00310  Lysine degradation
zal00362  Benzoate degradation
zal00380  Tryptophan metabolism
zal00620  Pyruvate metabolism
zal00630  Glyoxylate and dicarboxylate metabolism
zal00640  Propanoate metabolism
zal00650  Butanoate metabolism
zal00900  Terpenoid backbone biosynthesis
zal01100  Metabolic pathways
zal01110  Biosynthesis of secondary metabolites
zal01120  Microbial metabolism in diverse environments
zal01130  Biosynthesis of antibiotics
zal01200  Carbon metabolism
zal01212  Fatty acid metabolism
zal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:zal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZF00_05305
   00630 Glyoxylate and dicarboxylate metabolism
    AZF00_05305
   00640 Propanoate metabolism
    AZF00_05305
   00650 Butanoate metabolism
    AZF00_05305
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZF00_05305
   00072 Synthesis and degradation of ketone bodies
    AZF00_05305
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZF00_05305
   00310 Lysine degradation
    AZF00_05305
   00380 Tryptophan metabolism
    AZF00_05305
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZF00_05305
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZF00_05305
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZF00_05305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zal04147]
    AZF00_05305
Enzymes [BR:zal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZF00_05305
Exosome [BR:zal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZF00_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMO67749
UniProt: A0A127M3C3
Position
1209812..1210960
Genome map
AA seq 382 aa AA seqDB search
MAEAYIVDAVRSPTGRRKGGLAHVHGADLGAHVLKAIVERNGIPDNEYDDVIFGCVDAIG
PLAGDIARSAWLAAGLSDEVPGTTIDRQCGSSQQSVHFAAQAIMSGTMDVVVAGGVQTMT
QIPISSAMTAAIPMGFSDPFSGSTGWVARYGAEPPTQFKSAQMIAEKWGFSRRDLEEYSF
ESHQRALRAIAEGRFDREIIPFGDVKMDETPRNSSLEKMAELDFLFGCDKVTAAVSSQTC
DASSAMLLVSEDALKRYNLTPRARIHHISVRADDPIWMLTAPIAATAYALKKAGMSMQDI
DLVEINEAFASVSMAWLKETGYDHAKTNVNGGAIALGHPLGATGTKLMTTLLHELERTGG
RYGLQTMCEGGGQANVTIIERL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcctatatcgttgatgcagtacgcagtccaactggacgccgcaagggtggt
cttgctcatgtgcacggcgcagatttgggtgcccatgttttaaaagccatcgtcgagcgc
aatggtattccggataatgaatacgacgatgtgatctttggctgtgtcgacgccatcggt
ccattggctggggatattgcccgcagtgcgtggctggcggctggtttgtctgacgaggtg
ccgggcaccacgatcgatcggcagtgtggttcttcgcagcagtcggtgcattttgccgcg
caggccattatgtccggcaccatggacgtggtggtcgcgggtggcgtgcagaccatgacc
cagattccgatctcttcggcaatgaccgcggcgatcccaatgggttttagcgatccgttc
tcgggttcaactggctgggtagcgcgttatggcgccgagccaccaacccagtttaaatca
gcgcaaatgattgctgagaaatggggcttctcccgtcgggatcttgaagagtattcgttt
gagtctcaccagcgggccttgcgcgccattgctgaaggccgttttgatcgggaaatcatt
ccttttggcgacgtcaaaatggatgagacgccacgcaactccagtctagaaaaaatggct
gagctggatttccttttcggctgcgacaaagtgaccgccgccgtatcgagccagacctgt
gatgcgtctagtgcaatgttattggtcagcgaggacgccttaaagcgctataacctaacg
ccccgcgctcgtattcatcatatcagcgtgcgcgccgacgacccgatttggatgttaaca
gcgccgattgccgcaactgcttacgccttaaagaaagccggtatgtcgatgcaggacatt
gatcttgttgaaatcaatgaagccttcgcgtcagtgtctatggcctggttaaaagaaacc
ggctacgaccacgctaaaaccaatgttaacggtggcgccatcgcccttggtcatccactg
ggtgccaccggcaccaaacttatgaccacgctattgcatgagctcgagcgcactggtggc
cgctacggcctgcagacgatgtgcgaaggcggcgggcaggcgaatgtaacaattatcgag
agactttag

DBGET integrated database retrieval system