KEGG   Zhongshania aliphaticivorans: AZF00_05855Help
Entry
AZF00_05855       CDS       T04315                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00030  Pentose phosphate pathway
zal00480  Glutathione metabolism
zal01100  Metabolic pathways
zal01110  Biosynthesis of secondary metabolites
zal01120  Microbial metabolism in diverse environments
zal01130  Biosynthesis of antibiotics
zal01200  Carbon metabolism
Module
zal_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:zal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AZF00_05855
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AZF00_05855
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zal04147]
    AZF00_05855
Enzymes [BR:zal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AZF00_05855
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AZF00_05855
Exosome [BR:zal04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AZF00_05855
  Exosomal proteins of colorectal cancer cells
   AZF00_05855
  Exosomal proteins of bladder cancer cells
   AZF00_05855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AMO67853
UniProt: A0A127M3S1
Position
complement(1333293..1334753)
Genome map
AA seq 486 aa AA seqDB search
MTQNKATQLVIFGGTGDLALRKLQPALYKLQREGFLEDVCAIIALGRAQTSDDTYRDLVK
TKMQEFLPAHFWDEQHWQNFAAKLSFVSLDVNSLKDYHRLSDAVQHHSAATTVFYLATHS
TLYTSICRNLNSIGVVNAQSRVVLEKPLGHDLASCTEINHEVLQVFPEKNIFRIDHYLGK
ETVQNLLVLRFGNALFGPLWNSQYIDNIQITVAEDIGVEGRGDFYAKTGALRDMVQNHLL
QLLCLVAMEPPANLRADTIRDEKVKVLQALRPITATNVKAKTVRGQYIAGAVKSAPVAAF
LDETGFEDSENTETFVALQADVHNWRWEGTPFYLRTGKRLSRRFSEIIVELKKHPFSLFE
GDPNDLPNKLVIRLQPEENITLYKVNKKPGLSRQLKLEQVELNLDADLHDELQAHEAYER
LLLDVLEGDQTLFMRRDEVEACWAWVDSIISAWQEAGIQPKSYAAGSMGPNAALALPEKT
GRSWHE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaacaaagcgacacaacttgttattttcggcggtaccggtgacctcgccttg
cgcaagttgcaaccggcattgtacaaattgcaacgcgagggctttttagaggatgtatgc
gccatcatcgcattgggtcgcgcccagacaagcgatgacacataccgagacttagtaaag
accaagatgcaggaattcctccccgcgcacttctgggatgaacaacactggcaaaatttt
gccgccaaactcagctttgtgagcttagacgtaaactcactcaaagattaccaccgcctc
agcgacgccgttcagcatcacagtgccgccaccactgttttttacctggccacgcactcc
accttgtacaccagcatttgccgaaacttaaacagtattggcgtcgtcaatgcccagtcc
cgggtagtccttgagaaaccccttggccatgatttggctagctgcaccgagatcaaccac
gaagtgttacaggtgtttccggaaaaaaacatctttcgcattgaccactatcttggcaaa
gaaaccgttcagaatttattggtattacgttttggcaacgccctgttcggcccactgtgg
aatagtcagtatattgataatattcagatcaccgtggccgaagatattggcgtcgaaggt
cgcggtgacttctacgccaaaaccggcgccctgcgcgacatggtgcaaaaccatctgtta
cagcttttatgcttggtcgcaatggagccccccgccaacctccgcgccgatactattcgc
gacgaaaaggtaaaggtactgcaagcgctgcggccaattaccgccaccaatgtcaaagcc
aaaacggtgcgcggccaatatattgcaggcgcggtcaaatcggcaccagtcgccgcattt
cttgacgaaaccggctttgaagacagcgaaaatactgaaacctttgtcgccttacaggcc
gatgtacacaattggcgctgggagggcacgcccttttacttgcggaccggaaaacgcctg
agcagacggttttccgaaattattgttgaactaaaaaagcaccccttcagcttatttgaa
ggcgaccccaatgatctgcccaacaaactggtgattcgcctacagcccgaggaaaatatc
accctgtataaggttaataaaaaaccaggcctcagccgacaactaaaattagagcaagtc
gaattgaacctcgacgccgatttacacgacgaattacaggcccatgaagcctatgagcga
ctattattagatgtactagaaggtgatcaaacgctgtttatgcgccgagacgaagtcgag
gcctgctgggcgtgggtagacagcattatcagcgcgtggcaagaagcgggcattcaacct
aaaagctatgcggcgggcagcatggggccaaacgccgcactggcactgcctgaaaagact
gggagaagctggcatgaataa

DBGET integrated database retrieval system