KEGG   Zhongshania aliphaticivorans: AZF00_10020Help
Entry
AZF00_10020       CDS       T04315                                 

Definition
(GenBank) phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
zal  Zhongshania aliphaticivorans
Brite
KEGG Orthology (KO) [BR:zal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZF00_10020
Enzymes [BR:zal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     AZF00_10020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP Rbx_binding
Motif
Other DBs
NCBI-ProteinID: AMO68613
UniProt: A0A127M5R4
Position
complement(2248475..2249302)
Genome map
AA seq 275 aa AA seqDB search
MIVDLHTHTTASDGGLSPLELVQRARERGVQLLAITDHDTVAGFAALKDEAGAGMQLLAG
IELSCTWSGVNIHVLGLGIDTMAPAFVSELEGQRSARDSRAQLIGQRLDKLGFVGSYEAA
AELAAGRAIGRPDFARFLVAEGHVSSMAAAFDKYLGSGKLGDIKAVWPDLGEVVSWIRDA
GGVAVMAHPLQYKMTNAKLRRMLAEFKEVGGEGLEVCNGKPSNQDLAYLRQLCQQFELEA
SAGSDFHHPSSWSELGCDAKIIAPCKAVWDRWCTQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgattgttgatttacacacccacacgacggcttctgacggcggactttcgcccttggag
ttggttcagcgtgctcgtgagcggggtgtgcaattattggcgatcaccgatcatgacacc
gttgccggttttgctgcgcttaaggatgaggccggtgctggaatgcagttgctggccgga
atagagttgtcttgcacgtggtccggcgtgaatatccatgtactcggtttgggcattgat
actatggcccccgcgtttgtcagtgagctagaggggcagcgcagcgcacgagattcgcgc
gcccagcttatcggccagcgcttggataaactgggttttgtcggcagttatgaagctgcc
gcagagctggcggccgggcgagcaattggtcgtccggattttgctcgatttttggtggcc
gaggggcatgtcagctcaatggcggcggcctttgataagtaccttggctccggtaaatta
ggtgatataaaggctgtgtggcccgatttgggcgaagtcgttagttggattcgtgatgct
ggtggcgtcgcggttatggcgcatccgctgcaatataaaatgacgaatgcgaagttgcgg
cgcatgctggctgaatttaaagaagtgggtggcgagggcttggaagtgtgcaacggcaag
ccttctaatcaggacttggcgtatcttaggcagctttgtcagcagtttgagctggaagcc
tctgccggtagtgattttcatcacccaagcagctggtctgaattgggttgcgacgcgaaa
atcattgcgccttgcaaggccgtttgggatcgctggtgtacgcaatag

DBGET integrated database retrieval system