KEGG   Zhongshania aliphaticivorans: AZF00_11130Help
Entry
AZF00_11130       CDS       T04315                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00071  Fatty acid degradation
zal00072  Synthesis and degradation of ketone bodies
zal00280  Valine, leucine and isoleucine degradation
zal00310  Lysine degradation
zal00362  Benzoate degradation
zal00380  Tryptophan metabolism
zal00620  Pyruvate metabolism
zal00630  Glyoxylate and dicarboxylate metabolism
zal00640  Propanoate metabolism
zal00650  Butanoate metabolism
zal00900  Terpenoid backbone biosynthesis
zal01100  Metabolic pathways
zal01110  Biosynthesis of secondary metabolites
zal01120  Microbial metabolism in diverse environments
zal01130  Biosynthesis of antibiotics
zal01200  Carbon metabolism
zal01212  Fatty acid metabolism
zal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:zal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZF00_11130
   00630 Glyoxylate and dicarboxylate metabolism
    AZF00_11130
   00640 Propanoate metabolism
    AZF00_11130
   00650 Butanoate metabolism
    AZF00_11130
  Lipid metabolism
   00071 Fatty acid degradation
    AZF00_11130
   00072 Synthesis and degradation of ketone bodies
    AZF00_11130
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZF00_11130
   00310 Lysine degradation
    AZF00_11130
   00380 Tryptophan metabolism
    AZF00_11130
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZF00_11130
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZF00_11130
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZF00_11130
Enzymes [BR:zal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZF00_11130
Exosome [BR:zal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZF00_11130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMO68816
UniProt: A0A127M6H2
Position
complement(2507348..2508547)
Genome map
AA seq 399 aa AA seqDB search
MAEAFIYDAIRTPRGKGKRGGALYEVKPIDLVTNLLEALKSRHDLDTSKVEDLILACGEP
VKEQGQNIAKAALVYSTWDDSTTGAQLHRYCAGGLDAVNLAAAKVAAGYEDLVAAGGVES
MSRLGIGASGGATGDPWVAMKSYFISQGLGADMIATMDGFSREDVDRYAVMSQQRAAHAR
EQGYFKSIIPVKDFNGVTILDHDEFIRADTSMAALAKLKPAFQMFNDYGHGGVARLKYPQ
LENIECVHTPGNSSGIVDGAGLVLVGSERAGKEQNLQPRARILSCALVGTEPTLMLNGPA
PATQKALQKAGLTVDDIDLFELNEAFASVVLRYQRVLGIPDEKINVNGGAIAMGHPIGAT
GAMILGTLLDELERRNLKRGVVTLCAGGGIGIATIIERV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcatttatttatgatgcgattcgtacccctcgcggcaaaggtaagcgcggc
ggcgcgctttatgaagtaaaacccattgatctggtgaccaacctgctcgaagccctcaag
tctcgccatgacctcgataccagcaaggtcgaagatttgatcttggcctgtggtgaaccc
gtaaaagaacagggccaaaatatcgccaaagcggcgttggtttattccacttgggacgac
agcaccaccggcgcacagttacatcgctactgtgcgggcggtttagatgcagtgaacctc
gcggcggcgaaggttgccgctggctacgaagatttagtagcggcgggcggcgtcgagtct
atgtctcgtctcggcattggcgccagcggtggcgctactggcgacccgtgggtggccatg
aaaagctatttcatctcccagggtttgggcgcagatatgatcgccaccatggatggcttt
agccgagaagatgttgaccgctacgcggtgatgtcccagcagcgcgctgcccatgctcgc
gagcagggttattttaaatcgattatcccagtaaaagattttaacggcgtaacgattctc
gaccacgatgagttcattcgggccgatacctcaatggcggcattggccaaactcaagccc
gcgttccagatgtttaatgactatggtcacggcggtgtcgcaaggcttaaatacccgcag
ttggaaaacatcgagtgcgtgcatacgcctggaaattcgtcggggattgtcgacggtgcg
ggcttggttctcgtgggcagtgaacgcgcaggcaaggagcaaaacctccagccccgcgcc
cgtattctcagttgtgcgctggtcggcactgagcccacgttaatgttaaacggccctgcg
ccggcaacccagaaggcgctgcaaaaagccggactcaccgttgatgatattgatctgttt
gaattaaatgaggcctttgcctcggtggtgctccgctatcagcgtgtactgggtattccc
gacgagaaaatcaatgtgaatggcggtgctattgcgatggggcaccctattggcgccacg
ggggcgatgattcttggcacgctgctcgatgagcttgagcgccgcaatcttaagcgtggc
gtggttaccctctgcgccggtggcgggattggtatcgcaactatcattgagcgcgtgtaa

DBGET integrated database retrieval system