KEGG   Zhongshania aliphaticivorans: AZF00_11420Help
Entry
AZF00_11420       CDS       T04315                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00362  Benzoate degradation
zal00621  Dioxin degradation
zal00622  Xylene degradation
zal01100  Metabolic pathways
zal01120  Microbial metabolism in diverse environments
zal01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZF00_11420
   00622 Xylene degradation
    AZF00_11420
   00621 Dioxin degradation
    AZF00_11420
Enzymes [BR:zal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     AZF00_11420
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     AZF00_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AMO68871
UniProt: A0A127M6Q6
Position
complement(2570887..2571915)
Genome map
AA seq 342 aa AA seqDB search
MDLRGKKVVLHDMCLRDGMHAKQHQISLDEMKSIARGLDEAGMPLIEVTHGDGLGGASVN
YGFPAHSDEEYLKAVIGVVKNAKISALLLPGIGTVDHLKMAADLGVTTIRVATHCTEADV
SEQHIGMAAQMGLDTVGFLMMTHMIEAEQIVEQAKLMESFGANCIYCTDSAGYLLPDQVK
ERIALLRRELKPETELGFHAHHNLSLGVMNSLVAVEAGANRIDGSVAGLGAGAGNTPLEV
LVAVMDRMGVNHGIDLYKIMDVAEDLVTPIMDSPIRIDRDSLTLGYAGVYSSFLLFAKRA
AEKYGVSSRDILVELGKRRTVGGQEDMIEDLALDMAKARGLI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggatttacgcggtaaaaaagtcgttttacacgatatgtgcctgcgcgatggcatgcac
gccaaacagcaccaaatctccttggacgaaatgaagagcattgctcggggcttagatgag
gcgggtatgccgctaattgaagtgacccacggcgacggcttgggcggcgcttcagtgaat
tatggcttccccgctcacagcgacgaagaatacctcaaagccgtgattggcgttgtaaaa
aacgcgaaaatttcggccttattgctgccgggtattggcacggttgatcacttgaagatg
gccgcagatttgggcgtaacaaccattcgggttgccacccactgcaccgaagccgatgtt
tcagagcagcatattggcatggcggcccagatgggcctcgataccgtcggcttcttaatg
atgacccatatgatcgaggccgagcaaattgtcgagcaggctaagctcatggagtcattt
ggtgctaattgtatttattgcacggattctgcaggttatttattgccagaccaggttaag
gagcgcattgcgctattgcgtcgggagcttaagcccgagactgagcttgggtttcacgct
catcacaatctcagtttaggggtgatgaactcgctggtagcggtcgaggcgggtgcgaac
cgcatcgacggctcggtggcaggcttgggggccggtgcagggaatacaccgctggaggtc
ttggtggccgttatggaccgtatgggggtaaatcacggtattgatctctataaaattatg
gatgttgccgaggatttggttacccccatcatggatagtccaataagaattgaccgagat
tcgctgaccttaggttatgctggtgtttactcctcgttcttgctgtttgccaagcgcgcg
gctgaaaaatacggggtgtcatcccgtgatattctggttgagcttggcaagcgccgcacg
gtcggcgggcaggaggatatgattgaggatttggcgctggatatggcgaaggcgcgcggt
ttaatttaa

DBGET integrated database retrieval system