KEGG   Zhongshania aliphaticivorans: AZF00_11435Help
Entry
AZF00_11435       CDS       T04315                                 

Definition
(GenBank) 3-oxoacyl-ACP reductase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
zal  Zhongshania aliphaticivorans
Pathway
zal00984  Steroid degradation
zal01100  Metabolic pathways
zal01120  Microbial metabolism in diverse environments
zal01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AZF00_11435
Enzymes [BR:zal01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     AZF00_11435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Abhydrolase_3 Abhydrolase_5 Esterase PGAP1
Motif
Other DBs
NCBI-ProteinID: AMO68874
UniProt: A0A127M6J5
Position
complement(2573677..2574510)
Genome map
AA seq 277 aa AA seqDB search
MALQIAGLPEGQYATLANGQRIHYLDQGAGPIVVFLHGSGSGASGHSNFKYNYPYLVDQG
FRVIVPDLIGYGYSDKPDDVQYHLDFFVECIQQLLAQLDVERCVLIGNSLGGAIAIKYTL
DNPACVDKLVLMAPGGIEEQADYFHMPGMQVMKEVFTSGPMAPERLEDFIRRGLVYDDSI
VDQQLINERWGIFQQQNSQVITSMVVPNMASRLQEIECPVLAFWGVNEQMMPETGIQTLA
KNCRHIRLTLVSECGHWVMVEHRDMFNRNTADFLRNN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcattacagatcgcgggtttaccagagggtcagtatgccacgctagcgaatggccag
cgtattcactacttggatcaaggcgctgggcctattgtggtatttctacacggcagcggc
agcggcgcaagcgggcacagtaatttcaagtacaactacccttatttagttgaccaaggc
tttcgcgtcatcgtgccggatcttattggctatggttattccgataagcccgacgatgtg
caatatcacttggatttttttgttgaatgcattcagcaattactcgcccagcttgatgtt
gaacgctgtgttctcattggcaactctttaggcggtgccattgccattaaatacacctta
gacaaccccgcctgtgtggataaattggtactgatggcgccgggtggtattgaggaacag
gcagattattttcatatgcccggtatgcaggtgatgaaggaggtcttcacctctgggccg
atggcgccagagcgcttagaggactttattcgccggggcttggtgtacgacgatagcatc
gttgaccaacagcttattaatgagcgctggggcatatttcaacaacaaaatagccaagtt
atcacctcgatggtggtgcccaatatggcgtctcgcctccaagaaatcgaatgtccagtt
ttggcattttggggcgtgaatgaacaaatgatgccggaaaccggcatacaaaccctcgcc
aaaaattgtcgccatattcgtttaaccctagtttctgagtgtggccactgggtcatggtg
gaacaccgggacatgtttaatcgcaataccgccgattttttgagaaataattaa

DBGET integrated database retrieval system