KEGG   Zhongshania aliphaticivorans: AZF00_13705Help
Entry
AZF00_13705       CDS       T04315                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
zal  Zhongshania aliphaticivorans
Brite
KEGG Orthology (KO) [BR:zal00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AZF00_13705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AMO69295
UniProt: A0A127M7W1
Position
3096118..3096495
Genome map
AA seq 125 aa AA seqDB search
MPDSAPVDIQVESQFLPDQSVPEEQRFAFAYTITIRNTGEEAVRLINRHWIITDGANQVQ
EVQGEGVIGKQPLIEPGQSFSYTSGAVIETAVGTMEGSYEMISASGRPFIAPIGIFSLVR
PSALH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgccagattcagcccctgtcgacattcaggtagaaagccaatttctgccagaccaatcg
gtgccggaagaacagcgctttgccttcgcctacaccatcaccatccgcaatacgggtgaa
gaggccgtgcgcctgatcaatcgccactggataattactgatggcgcaaatcaagttcaa
gaagtacagggcgaaggcgttattggcaagcagccacttatcgaacccggccagtcgttt
agttacacctctggcgccgtgatagaaaccgccgtgggcaccatggaaggcagttacgaa
atgatcagcgcctccggtcggccctttattgcacccatcggcatattttcactagtccgg
ccctcggcgctgcactaa

DBGET integrated database retrieval system