KEGG   Zobellella denitrificans: AN401_02350Help
Entry
AN401_02350       CDS       T05100                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
zdf  Zobellella denitrificans
Pathway
zdf00260  Glycine, serine and threonine metabolism
zdf01100  Metabolic pathways
zdf01110  Biosynthesis of secondary metabolites
zdf01120  Microbial metabolism in diverse environments
zdf01130  Biosynthesis of antibiotics
zdf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AN401_02350
Enzymes [BR:zdf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AN401_02350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ATG72836
UniProt: A0A291HKT7
Position
510674..511726
Genome map
AA seq 350 aa AA seqDB search
MTQAPMFASDNASGVHPAIMAALADANRGHALGYGADELTARANRAFKQLFGDQAESFLV
YNGTGANVIALKGLVRSFEAVFCSAESHLWVDEAGAPEQFLGAKLITLPAHNGKIRIDDM
RPRLGDIGFQHRSQPRVISLAQCTERGSVYRPDELGAFCDFARAHGFYVHIDGARIHNAV
AALGGDCKRLFTELGVDVVSFGGTKNGLMMGEAVVVLNPALQAQYPVIRKHGMHLASKMR
FLAAQFLAYFEDDLWLHNAAQANAMAAYLAERLKAVPQARLVAPVETNMLFVELPNDWLA
PLQQQAYFHVWRADSSPGRSEARLVMSFDIERAHVDAFVARMGQLAAQEQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagctcccatgtttgccagcgacaacgcctccggggtgcaccccgccatcatg
gcggcgctggccgacgccaaccggggccatgccctgggctacggcgccgacgaactgacc
gcccgcgccaaccgggccttcaagcagctgttcggcgatcaggccgaaagcttcctggtg
tacaacggcaccggcgccaacgtcatcgccctcaaggggctggtgcgctctttcgaggcg
gtgttctgctccgccgagtcccacctgtgggtcgacgaggccggcgcccccgaacagttc
ctcggcgccaagctgatcaccctgccggcgcacaacggcaaaatccgcatcgacgacatg
cgcccgcgcctgggcgacatcggcttccagcaccgcagccagcccagggtgatttccctc
gcccagtgcaccgagcgcggttccgtctaccgcccggacgaactcggggccttctgcgac
ttcgcccgggcccacggcttctacgtgcatatcgacggcgcccgcatccacaacgcggtg
gcggcgctgggcggcgactgcaaacggctctttaccgagctgggagtggacgtggtgtcc
ttcggcggcaccaagaacggcctgatgatgggcgaggcggtggtggtgctcaacccggcc
ctgcaggcccagtacccggtgatccgcaagcacggcatgcacctggcctccaagatgcgt
ttcctcgccgcccagttcctggcctatttcgaggacgatctctggctgcacaacgccgcc
caggccaacgccatggcggcctacctggccgagcggctcaaggccgtgccccaggcccgg
ctggtggcgccggtagagaccaacatgctgttcgtggaactgcccaacgactggctggcg
ccgctgcagcagcaggcctacttccacgtctggcgggccgacagcagtcccggccgctcc
gaggcacggctggtgatgtcgttcgatatcgagcgcgcccatgtcgacgcctttgtggcg
cggatgggacaactggccgcacaggaacagtaa

DBGET integrated database retrieval system