KEGG   Zobellella denitrificans: AN401_03675Help
Entry
AN401_03675       CDS       T05100                                 

Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
zdf  Zobellella denitrificans
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AN401_03675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 CARDB
Motif
Other DBs
NCBI-ProteinID: ATG73065
UniProt: A0A231MWZ7
Position
complement(777809..778183)
Genome map
AA seq 124 aa AA seqDB search
MTPGAIHIATRPQYLADRSAPDEQHYVFAYTITIRNDGNERVRLISRRWLITDANGKKIE
VEGSGVVGEQPRIAPGEEYTYTSGVSLETPVGVMEGSYTMVLDDGREFQAPIAAFRLAMP
NLIN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgactcccggagccattcacatcgccacccggccccagtacctggccgacagatccgcc
cccgacgagcagcattatgtgttcgcctataccatcaccatccgcaacgacggtaacgag
agggtccgactgatcagccgccgctggctgatcaccgatgccaacggcaagaaaatcgag
gtggaaggcagcggcgtggtgggcgagcagccccgaatcgctccgggcgaagaatacacc
tataccagcggcgtcagcctggaaaccccggtgggagtgatggaaggcagctacaccatg
gtactggacgatggtcgcgaattccaggcccccatcgccgccttccgcctggccatgccg
aacctgatcaactga

DBGET integrated database retrieval system