KEGG   Zobellella denitrificans: AN401_09185Help
Entry
AN401_09185       CDS       T05100                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
zdf  Zobellella denitrificans
Pathway
zdf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AN401_09185
Enzymes [BR:zdf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AN401_09185
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AN401_09185
    1.1.1.-  
     AN401_09185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ATG75880
UniProt: A0A231MTZ7
Position
complement(1974198..1975286)
Genome map
AA seq 362 aa AA seqDB search
MSAAVWHGRQDIRLERVPRPAVPAPGWAQIRVHWCGICGSDLHEYLAGPVFIPVDEPHPL
TGLKGQCILGHEFCGEIVALGEGVAGFATGDRVTADACQHCGECRYCREGKINLCERLAF
TGLMNDGAFAEYVNVPANLLYRLPAGFPLEAGALIEPLAVGMHAVRQAGDITGKTLVVVG
AGTIGLCTIMCARAAGAGRIIALEMSTARKQKALEVGASLVLDPAHCDAVAEVKALTGGD
GADLSIECIGHKQTAKLAIDVLRKAGRCVLVGIFEEPSEFNFFDIVATEKQVVGALAYSG
EFAEVIALIDQGRMDVTPLITGRIPLDHIIEQGFEELVHNKDRNVKIIVSPGRAHATEGA
GS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgccgtctggcacggccgccaggatatccgcctggagcgggttccgcgtccg
gcggtgccggcaccgggctgggcccagatcagggtgcactggtgcggcatctgcggctcc
gatctgcacgaatacctggccgggccggtgtttattcccgtcgatgagccccatccgctc
accggcctcaaggggcaatgcatcctcggccacgagttctgcggcgagatagtggccctg
ggcgagggcgtcgcgggttttgccaccggcgaccgggtcaccgccgacgcctgccagcac
tgcggcgagtgccgctactgccgggaaggcaagatcaatctgtgcgagcggctagccttc
accggcctgatgaacgacggcgccttcgccgaatacgtcaacgtgcccgccaacctgctg
taccggctgcccgcgggctttccgctcgaggcgggcgccctgatagagccgctggcggtg
ggcatgcacgcagtccgccaggccggcgacatcaccggcaagaccctggtggtggtgggt
gccggcaccatagggctgtgcaccatcatgtgcgcccgggctgccggcgccggccgcatc
atcgccctggaaatgtcgacggcgcgcaaacagaaggcgctggaggtgggcgccagcctg
gtgctggatcccgcccactgcgatgcggtggccgaggtgaaggcactgaccggcggcgac
ggcgccgacctgtccatcgagtgcatcggtcacaagcagaccgccaagctcgccatcgac
gtgctgcgcaaggccggccgctgcgtgctggtcggcatcttcgaggagccgagcgagttc
aatttcttcgacatcgtcgccaccgagaagcaggtggtcggcgccctggcctacagcggc
gaattcgccgaggtcatcgccctgatcgatcaggggcggatggacgtcacgccgttgatc
accgggcgcatcccgctcgaccacatcatcgagcagggcttcgaggagctggtacacaac
aaggatcgcaacgtgaagatcatcgtgagccccggccgggcccacgccacagaaggagcc
ggatcatga

DBGET integrated database retrieval system