KEGG   Zobellella denitrificans: AN401_15600Help
Entry
AN401_15600       CDS       T05100                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
zdf  Zobellella denitrificans
Pathway
zdf00620  Pyruvate metabolism
zdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AN401_15600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zdf02000]
    AN401_15600
Enzymes [BR:zdf01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     AN401_15600
Transporters [BR:zdf02000]
 Other transporters
  Primary active transporters [TC:3]
   AN401_15600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 PTS_EIIA_1 HlyD_3 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ATG75109
UniProt: A0A291HSL5
Position
complement(3356069..3357859)
Genome map
AA seq 596 aa AA seqDB search
MTKPLAITDVVLRDAHQSILATRLRLEDMLPIAEKLDDIGYWSLETWGGATFDACIRYLG
EDPWERLRALKKAMPKTKQQMLLRGQNLLGYRHYADDLVYKFVERARTNGMDVFRIFDAM
NDVRNLETAIKATIAVDGHAQGTISYTTSPVHTLDMWVEMAKKLEDMGCHSICIKDMSGL
LKPYEAEKLIKSIKAAVKLPLALHCHATTGLSLPTHMKAIDAGIDMLDAAISSMSMTYGH
SPTETLVAMVEGTERDTGLDLVKLEEIAAYFREVRKKYARFEGSLKGVDSRILLAQVPGG
MLTNMESQLKEQGAADKMDEVLKEIPRVREDLGFIPLVTPTSQIVGTQAVINVLTGERYK
SITKETAGVLKGEYGAAPAPVNAELQKRVLDGAEPITCRPADLLSDELDKLTGEFTEVAK
AEGLRLATEVVDDVLTYALFPQIGLKFIRNRDNPAAFEPAPGSEPEPAAAPSAAKAASGA
PEVYAVKVDGQVFEVEVGPAGSISAVRESGAAAPVAAAAPVAAAGSGEPVPAPLAGNIFK
VVAKKGAQVAEGELLMIMEAMKMETEVRAARAGQIVDVLVKEGDSVSVGDPLVSLA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacctcttgccatcaccgacgtggtgctgcgtgatgcccaccaatccatcctg
gccacccgcctgcgcctggaagacatgctgccgatcgccgagaagctggacgacatcggc
tactggtccctggaaacctggggcggcgccaccttcgacgcctgtatccgctacctgggt
gaggatccctgggagcgcctgcgcgccctgaaaaaggccatgcccaagaccaaacagcag
atgctgctgcgtggccagaacctgctgggctatcgccactatgccgacgacttggtgtac
aagttcgtcgagcgtgcccgtaccaacggcatggacgtgttccgcatcttcgatgccatg
aacgacgtgcgcaacctggaaaccgccatcaaggccaccatcgccgttgacggccacgcc
cagggcaccatctcctacaccacgtcaccggtgcacaccctggacatgtgggtcgagatg
gcgaagaagctggaagacatgggctgccactccatctgcatcaaggacatgtccggcctg
ctcaagccctatgaggccgagaaactgatcaagagcatcaaggcggcggtcaagctgccc
ctggcgctgcactgccacgccaccaccggcctgagcctgcccacccatatgaaggccatc
gacgccggcatcgacatgctggatgccgccatctcctccatgagcatgacctacggccat
tcgcccaccgagaccctggtggccatggtggaaggcaccgagcgggataccggcctggat
ctggtcaagctggaagagatcgccgcctatttccgcgaagtccgcaagaagtacgccagg
ttcgaaggcagcctcaagggcgtggactcccgcatcctgctggcccaggtgcccggcggc
atgctcaccaacatggagagccagctcaaggagcagggcgcggccgacaagatggacgaa
gtgctgaaggaaatcccgcgggtgcgggaagacctgggctttatccccctggtgacgccc
acttcccagatcgtgggtacccaggcggtgatcaacgtgctcaccggcgagcgctacaag
agcatcaccaaggaaaccgccggcgtgctcaagggcgaatacggcgccgccccggcgccg
gtcaacgccgagctgcagaaacgggtgctggatggcgccgagcccatcacctgccgcccg
gcggatctgctgagcgacgagctggacaagctgaccggcgagtttaccgaggtggccaag
gccgaaggtctgcgtctggccaccgaggtggtggacgatgtgctcacctacgccctgttc
ccgcagatcggcctcaagtttatccgtaaccgcgacaatcccgccgccttcgaaccggcc
ccgggcagcgagcccgagccggccgccgccccgtccgccgccaaggccgccagtggcgcg
cccgaagtctatgcggtcaaggtcgacggtcaggtgttcgaggtggaagtgggcccggcg
ggcagcatcagcgccgtgcgtgaaagcggcgcggcagcgcccgttgcggcagcggccccc
gtcgcagcggcgggcagcggtgagccggtacccgcccccctggccggcaatatcttcaag
gtggtggccaagaagggcgcccaggtggccgaaggcgaattgctgatgatcatggaagcc
atgaagatggaaaccgaggtgcgtgccgcccgggccggtcagatcgtggatgtgctggtc
aaggaaggggactcggtgtctgtcggcgatcccctggtcagcctggcttaa

DBGET integrated database retrieval system