KEGG   Zobellia galactanivorans: ZOBELLIA_4249Help
Entry
ZOBELLIA_4249     CDS       T01586                                 

Gene name
nfnB2
Definition
(GenBank) 6,7-dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
zga  Zobellia galactanivorans
Pathway
zga00633  Nitrotoluene degradation
zga01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ZOBELLIA_4249 (nfnB2)
Enzymes [BR:zga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     ZOBELLIA_4249 (nfnB2)
  1.-  
   1.-.-  
    1.-.-.-  
     ZOBELLIA_4249 (nfnB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: CAZ98384
UniProt: G0KZH6
Position
4964308..4964967
Genome map
AA seq 219 aa AA seqDB search
MSLREILNWRYTTKAYDASKKISDADMAEIKNLLRMSPSSVNLQPWHFIIAETEEGKARM
AKGTQGFFHFNEPKISNASAVVLFCSKTDADEDYYKHIADTEDKNGRFPNEDIKNGFLGA
VKTFAGIHKYDLKDLQHWMEKQVYLNIGSFLLGVASLGIDATPMEGIDVKALDEEFGLRE
KGYTALVAVSLGYRAESDFNSTDKTPKSRLPESEILTVI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagcctaagagaaatattgaactggaggtacaccaccaaagcgtatgacgcaagtaaa
aaaatatccgatgcggatatggcggaaatcaagaatcttctaaggatgagtccatccagt
gttaacttacaaccttggcattttatcattgccgaaacggaagaaggaaaagcacgcatg
gcaaaaggaacccaaggattttttcattttaacgaacccaagataagcaatgcctcggcc
gtggttttgttttgttcaaaaaccgatgcggacgaagactactacaagcatattgccgac
actgaagacaaaaacggaagattccccaacgaggatataaaaaatggatttttaggtgcc
gttaaaacatttgccggtatccataaatacgatctaaaggacctgcaacactggatggag
aaacaagtttaccttaacataggaagcttcttattgggcgtggcaagtttaggtatcgac
gcaacgcccatggaaggaatcgatgtgaaggctttggatgaagaattcggattaagggaa
aaaggatatactgctttggtagccgtttccttaggatatagagcggaatccgatttcaat
tctacggataaaacaccaaaatccagattgcccgaaagcgaaattttaacggtgatataa

DBGET integrated database retrieval system