KEGG   Zobellia galactanivorans: ZOBELLIA_4435Help
Entry
ZOBELLIA_4435     CDS       T01586                                 

Gene name
hdc
Definition
(GenBank) Histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
zga  Zobellia galactanivorans
Pathway
zga00340  Histidine metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZOBELLIA_4435 (hdc)
Enzymes [BR:zga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     ZOBELLIA_4435 (hdc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2 SelA DNA_pol3_delta
Motif
Other DBs
NCBI-ProteinID: CAZ98570
UniProt: G0L412
Position
complement(5147863..5148981)
Genome map
AA seq 372 aa AA seqDB search
MDNERQIEELRAKLIQEKDRVIGYPVAKDFDYSSLYKFLAYPINNVGDPYEANTYKVQTH
EMEREVVDFFAQLFRAAPKDYWGYVTNGGSESNLYGLYLARELYPKAMVYFSESTHYSVR
KNIHLLNLSSITIRSQENGELDYEDLENTLQLNRDKPAIVLTTFGTTMTEAKDDVSKVKG
ILKKLAIQNHYIHCDAALAGAYGAFIEPRIPFDFEDGADSISISGHKFIGSPFPSGVILA
KRSLRDRIARSISYIGSLDTTITGSRNGHSALFLWYAIKKMGIKGLEARYRHSLETAEYC
KKELNNIGIPAWTNKGAITVVFPKVSPCIKEKWQLATDEATHIICMPNVTKRQIDEFIVD
MVSEKEPVASMA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggataatgagcgacaaatagaggagttacgggcgaaacttatccaagaaaaggatagg
gttatcggctaccccgtggccaaagactttgattactccagcttatataaatttttagcg
tatcctatcaataatgtcggggatccttatgaagccaatacctataaggtgcaaacccat
gaaatggaaagggaagtggtcgatttctttgcccaactgtttcgggcagcgccaaaagat
tattggggctatgtaaccaatgggggctctgagagcaatctgtacggactatatctggcg
agggaactctatccaaaggccatggtctatttttctgaatctacccattacagtgttaga
aaaaacatccatttgctcaacctttcgagcattaccatcaggtcgcaggaaaatggggaa
ctcgactatgaagaccttgagaataccctgcaactgaaccgcgacaaaccggctattgtg
cttactaccttcggcaccacaatgaccgaggccaaagacgatgtttccaaagtaaaaggg
attttaaagaaattggccattcaaaaccactatatacattgcgatgccgccttggcaggg
gcctatggtgcctttatcgaaccccgtatcccttttgactttgaagatggggcggacagt
atttccattagcggccataaattcatcggatcgccctttccttcgggggtgatcttggcc
aagcgttccttaagggatagaatagcccggagtatttcttatatcggttctttagatacg
accatcacagggtctagaaacgggcacagtgcgctctttttgtggtacgccataaagaaa
atgggaatcaaagggcttgaggcgcgttatcgccatagtcttgaaaccgccgaatattgt
aaaaaggaattgaataacataggcataccggcatggacgaataaaggggccattaccgtt
gtgtttcccaaggtgtccccttgcattaaagagaaatggcaattggctaccgatgaggct
acccatatcatttgtatgcccaatgtcacgaaaaggcagatagacgagtttattgtagat
atggtaagcgagaaggaaccggtggccagcatggcctaa

DBGET integrated database retrieval system