KEGG   Zobellia galactanivorans: ZOBELLIA_4766Help
Entry
ZOBELLIA_4766     CDS       T01586                                 

Gene name
coaBC
Definition
(GenBank) Coenzyme A biosynthesis bifunctional protein coaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
zga  Zobellia galactanivorans
Pathway
zga00770  Pantothenate and CoA biosynthesis
zga01100  Metabolic pathways
Module
zga_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ZOBELLIA_4766 (coaBC)
Enzymes [BR:zga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     ZOBELLIA_4766 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     ZOBELLIA_4766 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAZ98901
UniProt: G0L751
Position
complement(5506610..5507815)
Genome map
AA seq 401 aa AA seqDB search
MLGGKNILLGITGGIAAYKTTFLVRLLIKAGADVKVILTESASSFVSPLTLATLSKNPVL
SSFVHKDEGETDWNNHVELGLWADLMLVAPATANTLSKMASGTCDNLLLASYLSAKCPVF
FAPAMDLDMYRHPSTKIAFEKLRSFGNIMIPATSGELASGLHGEGRMAEPEDIVGFIKAY
LQKGLPLSGKKVLITAGPTYEAIDPVRFIGNHASGQMGYELAKVAANLGAHVTLVSGPSH
LAVSHDLVDLKKVSSAEEMYNEVHLHYKEMDIAICAAAVADYRPKTVANQKIKKKETEFS
IELVKTKDILLSLGDQKEKQFLVGFALETENELDNAIGKLKKKNLDAIVLNSLNDKGAGF
GKPTNKITFIDKNSEIKPFELKTKAEVAKDIFDEILKRYHA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctaggcggaaagaacatccttttaggcattaccggagggattgccgcttataaaact
acctttcttgtacgtttactgattaaagctggcgccgatgtcaaagttattttgacggag
agcgccagctcttttgtttccccacttaccctggcaacgctttctaaaaatccggtactt
tcctcttttgttcacaaagatgaaggggagaccgattggaacaaccatgtggaactcggg
ctgtgggcagacttgatgttagtggcgcccgctacggcaaatacattgtcgaaaatggcc
tcgggtacgtgcgataatttgctgttggcctcgtacttgtcggctaaatgtccggtattt
tttgccccggcaatggatttggatatgtacaggcatccgtctacaaaaatcgcttttgaa
aaattacggtctttcggtaatattatgattcccgcaacttcgggcgaattggcaagcggt
cttcatggtgaaggacgtatggccgaacctgaagatattgtaggcttcattaaggcctat
ctgcaaaaagggcttccgcttagcggaaaaaaggtcctgattactgccggacccacctat
gaagccattgaccccgtccgttttatcggaaatcatgcttctgggcaaatgggttatgag
ttggcaaaggtggctgcaaatttaggggcacacgttactttggtctctgggccttcccat
cttgccgtttcgcacgaccttgtcgatttaaaaaaagtaagctctgcggaagaaatgtac
aatgaggtgcacttgcattacaaagaaatggatattgccatttgcgctgctgcggtagcc
gattataggcctaaaacggtggctaatcaaaaaataaagaaaaaagaaactgaattttcg
attgaattggtgaagaccaaagacatcttgctctcattgggtgaccagaaggaaaaacag
tttttggttggttttgctttagagacagaaaatgaactggataatgcgataggcaagctt
aaaaagaaaaatttagacgccattgttcttaactcattgaacgataagggtgccggtttt
ggaaaacctacgaacaaaatcactttcatagataagaattctgaaattaagccgtttgaa
ctaaagacaaaggcagaggtggccaaagacatttttgacgaaatcttgaaaagataccat
gcgtaa

DBGET integrated database retrieval system