KEGG   Zobellia galactanivorans: ZOBELLIA_678Help
Entry
ZOBELLIA_678      CDS       T01586                                 

Gene name
pycA
Definition
(GenBank) Pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
zga  Zobellia galactanivorans
Pathway
zga00020  Citrate cycle (TCA cycle)
zga00620  Pyruvate metabolism
zga01100  Metabolic pathways
zga01120  Microbial metabolism in diverse environments
zga01200  Carbon metabolism
zga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZOBELLIA_678 (pycA)
   00620 Pyruvate metabolism
    ZOBELLIA_678 (pycA)
Enzymes [BR:zga01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     ZOBELLIA_678 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Biotin_lipoyl_2 ATP-grasp_4 HlyD_D23 RimK ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: CAZ94744
UniProt: G0L1J2
Position
complement(833395..836847)
Genome map
AA seq 1150 aa AA seqDB search
MKIEKVLVANRGEIAIRIFRACVEIGVRTVGIYTYEDRYSLHRYKADESYQIGEDNEPLK
PYLDIDAIIKVAKENNVDAIHPGYGFLSENAKFAQKCADNGIVFVGPKVSVLKALGDKIT
AKEVAVANNIPIIQSSDKDLKDVKTAIAEANRIGYPLMLKAASGGGGRGMRVIRTQEELE
KGFPEAKRESLNAFGDDTVFLEKFVENPKHIEIQIVADTHGNIVHLYERDCSVQRRYQKV
IEFAPSIGLPQETKDSLYRYAIAICKAVDYNNIGTVEFLVDDDGSIYFIEVNPRIQVEHT
VTEMITNIDLVKAQLFIAGGYKLSDTQIKIPNQESVQVTGIALQCRITTEDPSNDFKPDY
GVVTTYRSASGFGIRLDAGSIYQGVVISPFFDSMLVKVSARSRTLDGCCRKMRRALAEFR
IRGVNTNMAFLDNILKHETFREGKVTVNFIKNEPKLFEFTEPRNRANKLITFLGEVIVNG
NPDVKKLEPGRIFSKPTIPSFPKMDGHPRGTKDLLTELGPEQFAQWLKAEKKVHFTDTTM
RDAHQSLLATRMRTIDMMKVAEGYAKNHPEIFSMEVWGGATFDVCLRFLHENPWERLALL
RKAMPNVLLQMLIRGSNGVGYTAYPDNLIEKFVEESWNTGVDVFRIFDSLNWMKSIAPCI
EHVRTRTGGLAEGSICYTGDILNPSKTKYDLKYYVQLAKDIENAGAHILGVKDMAGLLKP
NAAFELIQALKSEINIPIHLHTHDTSSVQTATYLKAVEAGVDVVDVALGGLSGLTSQPNF
NSVLEMLRFHERENPMNTEKLAEYSNYWETVRNYYYTFESGLKSGTGDVYHHEIPGGQYS
NLKGQAIALGLEDKFTEVTKMYAEVNQMFGDIIKVTPSSKVVGDMAQYMISNNLSVADVM
EKGEDISFPESVKSFFRGDLGQPVGGFPKKLQKIVLKDEKPYTNRPNAHLEPIDFDKEFK
AFRRKFKKGMGRELEMTDFLSYKLYPKVFTDAYNNHVKYGNLVNIPTKNFFYGMEVGEEI
MVELEGGKNVLISLMLKGEPDEAGNVSIFFKINGQLRNILIKDTSVKVEKQENIKVDPSD
PKQIGAPLQGLLSNVLVKTGQEVKRNQPLFVIEAMKMETTVTATEEGVVAKIQLQGGSLV
NSEDLVLTLK
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagaaaaggttttagtagcgaacagaggtgaaattgccatacgtatttttagg
gcctgtgttgagatcggtgtgcgaacggttgggatctatacttacgaagaccggtattcc
ttacaccgctacaaagccgatgaatcgtatcaaataggggaggataacgaaccgttaaaa
ccctacttggatatcgacgccattataaaggtggccaaagagaacaatgtagatgccatt
cacccggggtacggatttttgtcggagaacgccaagttcgcccaaaaatgcgctgacaac
ggtattgtctttgtcggtcctaaagtttcggtattaaaggccttgggcgataagatcacc
gccaaggaggtagcggtggcgaacaatattcccataattcagagcagcgataaggacctg
aaggatgtaaagacggccatagccgaagccaatcgcattggttatcccttgatgttaaag
gcggcttcgggtggtggtggacgtggaatgcgcgtcattcggacccaagaggagcttgaa
aagggctttcccgaagccaaaagggagtcgttgaacgcctttggagacgatacggtcttc
ctcgaaaagtttgtagagaaccccaaacatatcgaaatacagatcgtggccgatacccat
ggaaacatcgtgcatttgtacgaacgcgattgttccgtacaaaggaggtatcagaaggtt
atagaattcgccccgtcgataggactcccacaagagaccaaggatagtctatatcgttat
gccatagccatttgcaaggcggtcgattataacaatatcggtacggtggagtttttggta
gacgatgacggtagtatctattttatagaggtgaatccgcgtattcaggtagagcatacg
gttaccgaaatgattaccaatatcgatttggtaaaggcccaactttttatagcgggagga
tataaactgtcggatacccagataaaaataccgaatcaagaatcggttcaagtaacgggt
atagcactgcaatgtagaataactactgaagacccatcgaatgacttcaaacccgattac
ggggtggtcactacttatagaagtgcttccggttttggtattcgtttagatgcgggaagc
atttatcaaggggtggttatctcgccttttttcgattccatgttggtaaaggtttcggcg
cgtagccgaacgcttgatggttgttgtagaaaaatgcgccgtgccttggccgaattccgt
atccgtggggtgaataccaatatggcctttctcgataatatcttgaagcacgaaactttt
cgcgagggcaaggtaacggtcaatttcattaagaacgaacctaaactttttgagttcacc
gaaccccgaaaccgggccaataagctgattacatttttaggggaggtcatagtaaacggc
aatcccgatgttaagaagcttgagcctggccgtatttttagcaaaccgacaattccttcc
tttccgaaaatggacgggcatccaaggggtaccaaggatttgttgaccgaattggggcct
gagcaatttgcccaatggctcaaggcggagaaaaaagtacattttaccgataccaccatg
cgcgatgcccaccaaagtttgttggcgacccgcatgcggaccatagatatgatgaaagtg
gccgaaggctatgccaagaatcatcccgaaatattttccatggaagtctggggaggcgcc
acttttgatgtttgcttgaggttcttgcatgaaaatccatgggagcgtttggccctgttg
cgtaaggccatgcccaacgtattgctgcaaatgcttattagaggttccaatggcgtaggg
tatacggcctatcccgataacctgatcgagaaatttgtagaagaatcgtggaatacgggc
gtagatgtctttaggattttcgattcgttaaactggatgaagtccattgccccatgtatt
gagcacgtacgaaccagaaccggtggtttggccgaaggttccatttgctatacgggcgat
attctaaatccctccaaaacaaagtacgacctaaaatactacgtgcaactcgccaaggat
atcgagaatgccggagcccatattttaggtgtaaaggatatggccggactcttaaagccg
aatgccgcctttgaattgatccaggctttgaaatctgaaatcaatattcctatccattta
catacccacgatacttcctcggtacagacggctacctatttaaaggcggtcgaagctggt
gtagacgtggtcgatgtggctttgggcggactttcgggactcacttcccagcccaacttc
aattcggtcttggagatgctccgctttcatgagcgcgagaatccgatgaataccgaaaaa
ctcgccgaatactccaactattgggaaactgtccgtaattactattacacttttgaatcg
ggattgaaatcgggtacgggcgatgtgtaccatcatgaaattcctggaggacaatattcc
aacctaaaaggacaggccattgccttggggcttgaggataagtttaccgaggtcaccaaa
atgtacgccgaggtcaaccaaatgttcggggatatcatcaaggttaccccgagctcgaaa
gtagtcggcgatatggcgcaatatatgatcagcaacaacctaagcgttgcggatgttatg
gaaaagggagaggatatttcttttcccgaatcggtaaaaagcttttttaggggagacttg
ggacaaccggtcggtggatttccaaagaaattgcagaaaatcgttctaaaggacgaaaag
ccatataccaacaggcccaacgcgcatctcgaacccatagattttgataaggagttcaag
gcttttaggcgaaagttcaaaaagggaatgggtagggaactcgaaatgaccgattttctt
tcctataaattatacccgaaagtctttaccgatgcctataacaaccatgtgaagtacgga
aatttggtaaatataccgacgaaaaatttcttctacggcatggaagtgggagaagagatc
atggtcgagctcgaagggggaaagaacgttctgatttcattgatgctcaaaggtgagccc
gatgaggccggtaacgttagtatcttctttaagatcaacggtcaacttagaaatattttg
atcaaggatacttccgtaaaagtggaaaagcaggaaaatataaaagtagacccgagtgat
cccaaacaaattggggcgccattgcagggactactttccaatgtacttgtcaagacgggc
caagaggtgaaaaggaaccagccgctcttcgttatcgaggccatgaaaatggagacgacc
gtaacggctaccgaagagggggttgttgctaaaatacaattacaaggggggtctttggta
aattccgaagatttggtattgactttaaaatag

DBGET integrated database retrieval system