KEGG   Zobellia galactanivorans: ZOBELLIA_883Help
Entry
ZOBELLIA_883      CDS       T01586                                 

Gene name
manC
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase [GDP]
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
zga  Zobellia galactanivorans
Pathway
zga00051  Fructose and mannose metabolism
zga00520  Amino sugar and nucleotide sugar metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ZOBELLIA_883 (manC)
   00520 Amino sugar and nucleotide sugar metabolism
    ZOBELLIA_883 (manC)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     ZOBELLIA_883 (manC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: CAZ94948
UniProt: G0L9Z4
Position
complement(1055280..1056362)
Genome map
AA seq 360 aa AA seqDB search
MKNKNYYAVLMAGGVGSRFWPISTSSYPKQFHDMLGTGDTLIQKTFKRLNKFVPTENILI
LTNERYNDLVLEQLPMVKQDQVVLEPAMRNTAPCILYAALKIQKMNENGVMIVAPSDHWI
EDEDAFAADVTTCFEKCEKEEVLCTLGIKPSFPNTGFGYIEFEKESAEGLKKVNQFREKP
DYETAKEFLAQGNFLWNAGIFMWSVKTIVNAFKNYQPEQYSLFESGMSCYNTGEEKEFIK
ENYPKAENISIDYAILENSKSIFVLPASFDWNDLGTWGSLYDKLDKDEDNNAVVNSKVVT
TDASGNMIRSPKDKIVVVDGLNDYIIVDKKEVLLIYPKSKEQDIKKVLGEVKDKFGDTYA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaaaattattacgcagtgttaatggccggaggtgtcggctcgagattttgg
ccgatcagtacgtcatcttatcccaagcaatttcatgatatgttgggtactggcgatacc
ttgatccaaaaaacctttaagcgtctgaataaatttgtgcctacggagaatattctcatc
ttgaccaatgagcgatataacgatttggtattggagcagcttcctatggtaaagcaggat
caagtggtacttgaaccggcaatgcgtaatacggcgccctgcattttgtacgcggcccta
aagattcaaaaaatgaatgaaaacggggttatgatcgtggctccgagcgatcactggatc
gaagatgaagatgctttcgccgcagatgtcaccacctgttttgaaaaatgcgaaaaagaa
gaggtgctttgtaccttaggtataaaaccatcgtttccgaataccggttttggttatatc
gaatttgaaaaggaaagtgccgagggcttgaagaaggtgaatcaatttcgggaaaaaccc
gattatgaaacggccaaggaatttttggcccaagggaattttctgtggaatgccggaatc
tttatgtggagcgtaaagaccattgtaaacgcctttaaaaattatcagcctgaacagtat
tccctttttgaatctggaatgtcttgttacaatactggcgaagaaaaggagtttataaaa
gaaaactacccgaaagcggagaatatctccatcgattatgcgattttggaaaactctaaa
tccatttttgtgcttccggcgtcatttgattggaacgatttgggtacttggggctcttta
tacgataaattggataaagacgaagacaacaatgccgtggtgaacagtaaggtcgttact
accgatgcatccggaaatatgataaggtcgccaaaagacaagattgtggtagtagatggt
cttaacgactatattatcgtagacaaaaaagaagtacttttaatttatccaaaatccaaa
gaacaggatatcaaaaaggttttgggcgaggttaaggataaatttggagatacatatgcc
taa

DBGET integrated database retrieval system