KEGG   Zobellia galactanivorans: ZOBELLIA_91
Entry
ZOBELLIA_91       CDS       T01586                                 

Gene name
rsmB
Definition
(GenBank) Ribosomal RNA small subunit methyltransferase B
  KO
K03500  16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
zga  Zobellia galactanivorans
Brite
KEGG Orthology (KO) [BR:zga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:zga03009]
    ZOBELLIA_91 (rsmB)
Enzymes [BR:zga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.176  16S rRNA (cytosine967-C5)-methyltransferase
     ZOBELLIA_91 (rsmB)
Ribosome biogenesis [BR:zga03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    ZOBELLIA_91 (rsmB)
SSDB
Motif
Pfam: Methyltr_RsmB-F Methyltransf_31 Ubie_methyltran Methyltr_RsmF_N Methyltransf_25 MTS PCMT Met_10 GCD14 FtsJ Methyltransf_15 N6_Mtase SPACA7 Methyltransf_4 Methyltransf_11 Prismane LON_substr_bdg
Other DBs
NCBI-ProteinID: CAZ94164
UniProt: G0L8U2
Position
94783..95994
AA seq 403 aa
MKLHRNLVFAVIDALNLIFNEGEYADKVVQKVLKFDKRWGARDRGFIAETTYEMVRYKRL
YTEIAEVKAPFSRPDLFRMWAVWAVLKGIKLPDWKQLEPTPERRIKGRFDELSKIRKYRE
SLPDWIDEICLKALGEKLWNEESAALNQQAEVILRTNTLKTKKETLRKALLDEGIVAEPI
KGYADALRLPERANVFVTESFKKGYFEVQDASSQLVAAYLDVKPGQRVVDTCAGAGGKSL
HLAALMENKGQLIAMDIYGSKLKELKRRARRNNAHNIETREIDSTKVYKKLYGSADRVLI
DAPCTGLGVLRRNPDSKWKMQPEFLEKITKTQHEIIRNYSKIVKPGGKMVYATCSILPQE
NNDQVQSFLASEEGKDFSLVKEKKIYASKSGFDGFYMALLEKK
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaagctacatagaaacttggttttcgcagtaatcgatgccttgaacttgatttttaac
gaaggggagtatgccgataaggtggtacagaaagtactaaagttcgataaacgttggggt
gcccgagatcgcggctttattgccgagaccacttatgaaatggtccgctacaaacgtttg
tataccgaaattgccgaggtaaaggctcccttcagtagacccgacctttttagaatgtgg
gccgtatgggccgttttaaaaggaataaaacttccagattggaagcaacttgaacctaca
ccggaacgtcgtatcaaagggcgttttgacgaactttcgaaaataaggaaataccgcgag
tcactacccgactggatcgatgagatctgtcttaaggctttaggggaaaagctatggaac
gaagaaagtgccgcactcaaccaacaggccgaagtaattttaaggaccaataccttaaag
accaaaaaggaaacccttcgcaaggccttattggatgaaggtatcgttgccgaacctatc
aaaggatacgccgatgccctccgattacccgaacgcgccaatgttttcgttaccgagtct
ttcaaaaaaggatattttgaggtacaagatgcctcttcacagttggtggccgcatattta
gatgtaaagccaggacaacgtgtggtcgatacctgcgccggtgccggtggaaaatcactt
cacttggcggcccttatggaaaacaagggacaacttatcgctatggatatctatggcagt
aagcttaaggaactgaaacgacgtgccagaagaaacaatgcccataacatcgaaacccgc
gaaatcgattctaccaaggtctataaaaaattatacggcagtgccgatcgcgttttgata
gatgccccatgtacgggtcttggcgtgcttcgcagaaatccggatagcaaatggaaaatg
cagcccgagtttcttgagaagattacgaaaacgcagcacgagatcattcgcaactatagc
aaaatcgttaaaccgggcggaaaaatggtgtatgccacctgctctatccttcctcaagaa
aacaacgaccaggtacaatcttttctagcttcagaggaaggaaaagacttcagtttggtc
aaggagaaaaagatatatgcctccaaaagtgggtttgacggtttctatatggcattgcta
gaaaagaagtaa

DBGET integrated database retrieval system