KEGG   Zobellia galactanivorans: ZOBELLIA_3132Help
Entry
ZOBELLIA_3132     CDS       T01586                                 

Gene name
rocD
Definition
(GenBank) Ornithine aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
zga  Zobellia galactanivorans
Pathway
zga00330  Arginine and proline metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZOBELLIA_3132 (rocD)
Enzymes [BR:zga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     ZOBELLIA_3132 (rocD)
Amino acid related enzymes [BR:zga01007]
 Aminotransferase (transaminase)
  Class III
   ZOBELLIA_3132 (rocD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CAZ97271
UniProt: G0KZZ2
Position
3621604..3622848
Genome map
AA seq 414 aa AA seqDB search
MSVLEKITSEGAIALEDKYGAHNYHPLPVVLTKGEGVYVWDVEGKKYYDFLSAYSAVNQG
HCHPKIVKAMTDQAHTLTLTSRAFYNDMLGKYEKYATETFGFDKLLPMNTGAEAVETALK
VCRKWAYEKKGLNENEAQIVVCENNFHGRTTTIISFSNDPVARKNFGPYTAGFIKIEYDN
LEALAEVLEQNHNIAGFLVEPIQGEAGVYVPSEGYLRKAKALCEKHNVLFIADEVQTGIA
RTGKMLAVDHENVKPDILILGKALSGGAYPVSAVLANDEVMGVIKPGNHGSTFGGNPIAA
AVAIAALEVVKNEELAQNAETLGLLFRDELNKFIPNCNVVNGVRGKGLLNAILINDTEDS
STAWDICMALKENGLLAKPTHGNIIRFAPPLVMNREQLLDCVEIITTTLKRFEK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttagaaaaaatcacttctgaaggtgctattgcattggaggataagtacgga
gcacacaactatcacccattgccagtggtactcactaagggagaaggggtttatgtttgg
gatgttgaagggaaaaaatattatgatttcctttcggcctactccgcagtaaaccagggg
cattgccacccgaaaattgtcaaggccatgaccgatcaggcgcataccttgacccttacc
tcaagggcgttttacaacgatatgctcggaaagtatgaaaagtatgccacggaaactttc
ggctttgacaagttgttgcctatgaacacaggtgccgaggccgttgagaccgcattgaaa
gtgtgccgaaagtgggcctatgagaaaaaaggcttgaacgagaacgaggcacagatcgtt
gtttgtgaaaacaattttcatggaagaaccaccacaatcatttcgttttcgaacgacccg
gtggcccgtaagaatttcggaccctatacggccggatttattaaaatagaatatgataac
ctagaggctttggccgaggtgcttgaacaaaaccataacatagctggttttttggtcgag
cctattcaaggggaggcgggagtatacgttccttctgaaggttatttaaggaaagccaag
gcattgtgcgaaaagcacaacgtactttttatagccgatgaggtccagaccggaatagcc
cgaacaggtaagatgctggcagtagaccatgagaacgtaaagcctgatatcttgatattg
ggaaaagcgctttctggaggagcttaccccgtttccgctgttttggccaacgatgaagtt
atgggggtgatcaaacctggaaaccacggcagtacttttggcgggaaccctattgctgcg
gccgtggccattgcggcattagaggtagtcaaaaatgaggagttggcgcaaaatgccgag
acactcggactactgttcagggatgagttgaacaaatttataccgaactgcaatgtggtg
aacggcgtaaggggtaaagggttgttgaatgcaattcttatcaatgatacggaagacagt
tcgaccgcatgggatatttgtatggccctaaaggaaaacggacttttggccaaacctacc
catggcaacattattcgctttgcaccgcccctggtaatgaacagggagcaactgttagat
tgcgttgagatcataacaacaacattgaaacggttcgagaaataa

DBGET integrated database retrieval system