KEGG   Zobellia galactanivorans: ZOBELLIA_3716Help
Entry
ZOBELLIA_3716     CDS       T01586                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
zga  Zobellia galactanivorans
Pathway
zga00010  Glycolysis / Gluconeogenesis
zga00620  Pyruvate metabolism
zga00640  Propanoate metabolism
zga00680  Methane metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01120  Microbial metabolism in diverse environments
zga01130  Biosynthesis of antibiotics
zga01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZOBELLIA_3716 (acs)
   00620 Pyruvate metabolism
    ZOBELLIA_3716 (acs)
   00640 Propanoate metabolism
    ZOBELLIA_3716 (acs)
  Energy metabolism
   00680 Methane metabolism
    ZOBELLIA_3716 (acs)
Enzymes [BR:zga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ZOBELLIA_3716 (acs)
Lipid biosynthesis proteins [BR:zga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ZOBELLIA_3716 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAZ97854
UniProt: G0L1R3
Position
complement(4345222..4347129)
Genome map
AA seq 635 aa AA seqDB search
MSNYHIKHLEEYYQVYRKSVRNPEAFWEEIAEEHFVWRKKWDNVLSWDFSKPEIKWFEGA
KLNITENCIDRHLPTRGEKTAILFEPNDPNEEAQHITYRQLHERVCRMANVLKDHGVKKG
DRVCIYLPMIPELAISLLACARIGAIHSVVFAGFSSNALATRINDSDCKVVLTSDGSYRG
SKTIDLKGLVDKALEECPGVHTVLVTNRINGKVEMKEGRDKWLQPLLDEAYADCVAEIMN
AEDPLFILYTSGSTGRPKGMVHTTAGYMVYTAYTFKNTFQYREEDVYWCTADIGWITGHS
YIVYGPLANGATTVMFEGVPSYPDFGRFWQVVQKHKVNQFYTAPTAIRALAKENLEFIDK
YDLSSLKVLGSVGEPINEEAWHWYNNNVGKKMSPIVDTWWQTETGGIMITPIPYVTPTTP
TYATLPFIGIQPALMDEEGKEIKGNQVSGRLCIKFPWPSIARTIWGDHDRYRDTYFSAYK
NMYFTGDGALRDAVGYYRITGRVDDVIIVSGHNLGTAPIEDSINEHPAVAESAIVGFPHD
IKGNALYGYVILKEFGETRDRENLRKEINQQITEHIGPIAKLDKIQFVTGLPKTRSGKIM
RRILRKIASKDISNLGDTSTLLNPEVVEEIIENSL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattatcacattaaacacttagaggaatattatcaagtatacagaaaatcagta
agaaaccccgaagccttttgggaagaaatcgccgaagagcactttgtatggcgaaaaaag
tgggacaacgttctaagctgggactttagcaaacccgaaataaaatggtttgaaggcgca
aaactcaacatcaccgagaactgcatagaccggcacctccctacgcggggcgaaaagacg
gccattctatttgaaccgaacgaccctaatgaagaagcccagcatattacatatagacaa
cttcacgaaagggtctgccgtatggcaaacgtactgaaagaccacggtgtcaaaaaaggc
gatagggtctgtatctacctccccatgattcccgagctggccatttcccttttggcctgt
gcccgaatcggagcgatacattccgtagtctttgccggtttttcatccaacgcattggcc
acccgcatcaatgattccgattgtaaggtagttttgacttccgacggttcctatcgcggt
tcaaaaaccatagacctgaaaggtcttgtcgacaaagccctagaagaatgtcccggcgta
cataccgtacttgtcaccaatcgtatcaacggtaaagtagaaatgaaggaaggccgtgac
aaatggctacaacctttacttgatgaggcatacgccgattgtgtggccgaaataatgaat
gccgaagacccacttttcattttatacacctcaggttcaaccggtcgcccaaaaggtatg
gtgcacaccaccgcaggttacatggtatacactgcatatacatttaaaaacacatttcaa
tatagggaagaggacgtatactggtgtaccgccgatatcggatggattacaggacactcg
tatatcgtttacggccccttggccaacggggccacgaccgttatgttcgagggcgtgccc
tcatatcccgattttgggcgcttttggcaagtggtccaaaaacacaaagtcaatcaattt
tatacggcacctacggccatacgggccctagcgaaggaaaatctcgaatttatagacaag
tacgacctctcttccttaaaagtactaggttcggtaggagaacctattaacgaagaagca
tggcactggtacaacaataatgtaggtaaaaaaatgagcccgatagtagatacttggtgg
cagaccgaaacgggaggtatcatgatcacccccataccctacgtcacccctactacccca
acatacgccaccctgccttttataggcatacaaccggccttgatggacgaagaaggaaaa
gagatcaaaggaaaccaggtatcgggaaggttatgcattaaatttccatggccttctatc
gcccgaaccatttggggagatcacgaccggtacagggacacatatttttcagcctacaag
aatatgtattttacaggcgacggtgcattgcgcgacgccgtaggttactaccgaattacc
gggcgtgtcgacgatgttatcattgtttccggccataacctgggtacggcccctatagag
gattccatcaacgaacaccctgccgtggcagaaagtgccattgtaggtttccctcacgac
ataaagggcaatgccttgtacggctatgtaattctcaaagaatttggggaaacccgagac
cgcgaaaacctacgaaaggaaatcaatcaacagattaccgaacacatcgggcctatcgcc
aaattagacaagatccagttcgttacaggactgccaaaaacccgaagcggaaaaattatg
cgccgaattttgcgtaagatcgcttcaaaagacatctccaaccttggggacaccagcaca
ctcctgaatcccgaagtcgttgaagaaattatagagaactccctataa

DBGET integrated database retrieval system