KEGG   Zobellia galactanivorans: ZOBELLIA_399
Entry
ZOBELLIA_399      CDS       T01586                                 

Definition
(GenBank) PKD repeats protein
Organism
zga  Zobellia galactanivorans
SSDB
Motif
Pfam: PKD_4 PKD Toprim_N
Other DBs
NCBI-ProteinID: CAZ94472
UniProt: G0L9B4
Position
complement(535250..536284)
AA seq 344 aa
MIHKRIKTHFDKNVFISFLVLVIFGLGLLSFRLNSKVDCSNVDFEMIAESYTTADLIEFK
SIDPSGVEWEWDFGKDIPKKYRSNVVHQFTKEGTYTVSLKMNGQCGVTKQIEISKPKDLI
VPELIPNIILPEYVRVGQEVEFSNDSEFAESWQWSFGESMTIDGNNRKEKYVYKSPGEKT
VLLVVNGDRRHEAKQRITVLPEKKSRKRRASITRVDPIETVLQDQIRDKPKAEDKAAADA
EQRKKEEVANRIEVSNDDMQQMFISYSGRNLDDISIRKYFCYSNIPVFNKTGNRFTVSQF
FKEIRDVNKLEIKSIKMIKDKKTGCVKSMTIDMRTKKGLFWKTF
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgattcataaaaggattaaaacccactttgacaaaaacgtatttatctcttttttagta
ttggtgatttttggtcttgggcttttatcatttagattgaacagtaaggtagactgtagc
aatgttgattttgaaatgattgccgaatcttataccactgccgatttgatcgaatttaaa
agtatagacccatcgggcgtggagtgggagtgggattttggaaaagatattcctaaaaaa
tacaggtctaatgtggtgcatcagttcaccaaggaaggtacttatacggtatccttaaaa
atgaacggtcaatgcggggtgacaaaacagattgaaatttcaaaaccgaaggacctgatc
gttcctgaactgattcctaatataattcttcccgaatacgtaagggtcggccaagaagtt
gaattctcgaacgattcggaatttgccgagtcgtggcaatggagctttggggagtcgatg
accattgatggcaacaatcgcaaagagaagtatgtctataagagtcccggggaaaaaacc
gttctattggtcgtgaatggcgataggcgtcatgaagccaagcagcggattaccgttttg
ccggaaaagaaaagtagaaaaagaagggcaagcataacccgtgtagatcctattgaaacg
gttcttcaagatcagataagggataaacccaaggccgaagataaggctgctgcggatgcg
gaacaaaggaaaaaggaagaagttgccaatagaatagaagtgtcaaacgatgatatgcag
caaatgtttatttcctattccggtaggaaccttgatgatatttccattcgaaaatacttc
tgttatagtaatatacctgttttcaataaaacaggcaaccggtttacggtgagccagttt
tttaaggaaataagggatgtgaacaaactagagatcaagagtataaaaatgatcaaggat
aagaaaacaggttgcgtaaaaagtatgaccatcgatatgcgaaccaaaaaaggcttgttc
tggaagaccttttaa

DBGET integrated database retrieval system