KEGG   Zobellia galactanivorans: ZOBELLIA_401Help
Entry
ZOBELLIA_401      CDS       T01586                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
zga  Zobellia galactanivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAZ94474
UniProt: G0L9B6
Position
536979..537884
Genome map
AA seq 301 aa AA seqDB search
MKDFPENDIRQEVFNLDFDLKAETLLSYIEEDTQVDLSLSDFFKRRFSKDITRIEKDRYN
DDTLNVHLSRRSFYNVLPERFFHSTYISTPFVNTMVADYHGRKIEQENALKFFKPLETEF
FLHRVDIESAENEILTALGSPKLVDFLMDLWKIDERIPKRMAAKILKTMPFMYKIAGNIP
LLKKILENIIEEEILIEKDFATAGLPVTNEPWQLGVNMATSGKQKTFLPKYIFTMNNISR
PENIEDYLPDGKITAVVNFFLEHTLPHESDFEINFRLPKRKTRFIMTEDAYSGRLGISAT
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttccccgaaaacgacatacgccaagaggtattcaatttggattttgaccta
aaggcggaaaccctactttcctatattgaggaagatacccaggtcgatctttcgctcagc
gacttttttaagcgtcgctttagtaaagatatcacccgtattgaaaaagaccgttataat
gatgataccctgaacgttcacctaagtcgacgtagcttttacaatgttttgcccgaacgt
ttctttcattccacctatattagtactccttttgtaaataccatggtggcggattaccat
ggcagaaaaattgaacaggagaatgccttgaagtttttcaaacccttggaaaccgagttc
tttcttcatcgtgtcgatatcgaatctgccgaaaacgaaatcctaacagccttgggaagt
cccaaattggttgactttttaatggatttatggaaaatagacgaaaggattccgaaacgt
atggcggcaaaaattttaaaaactatgccgttcatgtataaaatagccggaaatattccg
ttgttaaaaaagatacttgaaaatatcatagaagaagagatcttgatcgagaaagatttt
gctaccgcaggcctacctgttacgaacgaaccatggcaacttggcgtgaatatggcgacc
tcgggaaaacaaaagacctttctgcctaaatatatttttacaatgaacaacattagccgc
cctgaaaacatagaggattacctgcctgacgggaaaataacggctgtcgtcaatttcttt
ttggaacataccttgccccatgaaagtgattttgaaatcaacttcaggctacctaagcgt
aaaacaagatttataatgaccgaggacgcctattcaggtagacttggaatatcggcaaca
atttaa

DBGET integrated database retrieval system