KEGG   Zobellia galactanivorans: ZOBELLIA_406
Entry
ZOBELLIA_406      CDS       T01586                                 

Definition
(GenBank) Conserved hypothetical protein
Organism
zga  Zobellia galactanivorans
SSDB
Motif
Pfam: GPW_gp25 TetR_C_13
Other DBs
NCBI-ProteinID: CAZ94479
UniProt: G0L9C1
Position
543087..543521
AA seq 144 aa
MAKPYYQAPFDFKRFFEKKELKKIGMRDSISQFISVIITTYFEEYTFDEAFGSEIWETDF
DLLINANVLKERIKKSLKNQIETYEKRLSNIDLNVELMESLSSNTNKVRLKKYLYITIKG
TIIKTDEPFSFTGDYYLAPLSYKH
NT seq 435 nt   +upstreamnt  +downstreamnt
atggcaaaaccctattatcaggcaccttttgattttaagcgttttttcgagaagaaagag
ctcaagaaaatcggtatgcgcgactctatctcccagtttattagcgtgatcattacgacc
tatttcgaggagtatacgtttgatgaagcttttggtagtgaaatatgggaaaccgatttc
gatcttttgataaatgccaacgtccttaaggaacgcatcaaaaaatcgctgaaaaatcag
attgaaacctacgaaaaacgcctttcgaatatcgatttgaacgttgagctcatggaaagc
ctgtcttccaacaccaacaaagtaagactcaaaaaatatctatatatcactattaagggg
accattataaaaaccgatgagcccttttcatttacaggggattattacttggctcccttg
tcgtacaaacattga

DBGET integrated database retrieval system