KEGG   Zobellia galactanivorans: ZOBELLIA_408
Entry
ZOBELLIA_408      CDS       T01586                                 

Definition
(GenBank) Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
zga  Zobellia galactanivorans
Pathway
zga03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:zga00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ZOBELLIA_408
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:zga02044]
    ZOBELLIA_408
Secretion system [BR:zga02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ZOBELLIA_408
SSDB
Motif
Pfam: Phage_base_V Phage_GPD DUF2345 DUF3540 Sarcoglycan_1 NAGLU_N DUF4524
Other DBs
NCBI-ProteinID: CAZ94481
UniProt: G0L9C3
Position
545524..547359
AA seq 611 aa
MSKIVNSKLLVGGEEFLPNSGYSVTVEQSIGGHSAFRIAFPSNATEGYAGALMDNALAYV
GKKITIGINENQMEFKGVVTSVDLQKGADAAGTIVLSGHGPAALLANSVQCLSYEEGTPL
SQVATDTVNGHSTEHVKLSIGKGTDVSLPYTVQYNESDLAFLQRLCSRYGAWIYHNGTDF
CVGRTGDKQVHGIYGQDVQGFNLSTVLREQSFGLKARDWVNDTDLEADASAFAPSSSHPY
QDRIKGESQNVFAKRSSYDWSVGQHEYSAQSGVDTATKVNAMGKAASMILASGTSELVGL
RVGDTLTLEGLNFSDQGKKDPYGSYDITKVVHRFDHSGHYRNEFEGVPEGTEHLPYSNSF
AAPRSGAQRGWVLDNADPEGLGRIKVQFPWQRPMGTSTPWIKMATPYSGSDKGFYFIPEK
EEEVLVGFEADNPEKPFVLSAGFNSSAKSGLADADNNIKAIKTRSGHIIELNDTDGGESI
TIKDKNENIFQIDTASNDITINANNNVNVNAENNVTLTAKETIKFSAKNIQLDAQEDITA
GASRNISASAGETVNTMAKNKNDIIDNEIMINAKKLEETADEISVNSTSKNLTLFSQKSV
DVQSNEKVKLF
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgtccaaaatagtaaacagcaaactccttgtaggaggagaggaattcttgcccaattcg
ggctatagcgttaccgtagaacagtccattggagggcacagcgccttccgtatcgccttc
ccttccaatgccaccgaaggctacgcgggcgccttgatggacaatgccctggcctatgtg
ggcaagaagatcaccatcggcatcaacgaaaaccaaatggaattcaagggcgtggtcacc
tcggtagacctccaaaagggggccgatgccgcaggtaccatcgtactgtcgggccatggg
ccggcggccctcttggccaattccgtccagtgccttagctacgaagagggtacgccccta
tctcaggtggctaccgataccgtgaacggacattccaccgaacatgtaaaactttccatc
ggcaagggcaccgacgtaagcctgccctataccgtacaatataacgagagcgacctggcc
ttccttcaacggctctgcagccgctatggggcctggatctaccataacggcaccgatttc
tgcgtgggcaggaccggggacaaacaggtgcacggcatttacggacaagatgtacagggc
tttaacctttccaccgtgctcagggagcagtccttcggacttaaggccagggactgggtc
aacgacaccgatctggaagccgatgcatcggccttcgccccaagctcgtcacacccctac
caagaccggataaagggcgaatcgcaaaacgttttcgccaagagaagttcctatgattgg
agcgtaggccagcacgaatacagtgcgcaaagcggcgtagataccgccacaaaggtcaac
gccatgggaaaggcggccagtatgatattggcctcgggcacttcggagctcgtgggcctt
cgcgtcggcgataccctcaccttggaagggctcaatttttccgaccagggcaaaaaggac
ccctacggttcctatgatatcaccaaggtcgtacacaggttcgaccatagcggacattac
cgcaacgagttcgagggcgtgcccgagggcaccgaacacctgccctactccaacagtttt
gccgctccccgatcgggcgcgcaaaggggctgggtgctcgacaatgccgatccggaagga
ctcggacgtatcaaggtgcagttcccctggcagaggcccatgggtaccagtacaccctgg
ataaagatggccaccccctactccggtagcgacaagggcttttacttcatccccgaaaag
gaagaagaggtcttggtcggtttcgaggccgacaaccccgaaaagccctttgtactcagt
gccggctttaacagcagtgccaaaagcggcctggccgatgccgacaacaacatcaaggcc
atcaagacccgtagcgggcatatcatagagctcaacgataccgacggtggggagagcatt
acgatcaaggataagaatgagaatatttttcagatcgatacggcgagtaacgacattacc
atcaatgcgaataacaatgtaaatgttaatgcagaaaataacgttacgcttaccgccaag
gaaaccataaaattttcagctaaaaatatacaattagacgcacaggaagatattacggcc
ggagcaagtagaaatattagtgctagtgctggagaaaccgtcaataccatggccaaaaac
aaaaatgatattatcgacaacgaaattatgatcaatgctaaaaaattagaagaaactgct
gacgaaatctccgtgaacagtacatccaaaaatttgactttattttctcaaaaatctgtt
gatgtacaaagcaatgaaaaggtaaaattattttaa

DBGET integrated database retrieval system