KEGG   Candidatus Zinderia insecticola: ZICARI_087Help
Entry
ZICARI_087        CDS       T01304                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zin  Candidatus Zinderia insecticola
Pathway
zin00260  Glycine, serine and threonine metabolism
zin00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zin01100  Metabolic pathways
zin01110  Biosynthesis of secondary metabolites
zin01130  Biosynthesis of antibiotics
zin01230  Biosynthesis of amino acids
Module
zin_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zin00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZICARI_087 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZICARI_087 (trpA)
Enzymes [BR:zin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZICARI_087 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA RhoGAP-FF1
Motif
Other DBs
NCBI-ProteinID: ADM89706
UniProt: E0TIS9
Position
complement(84048..84836)
Genome map
AA seq 262 aa AA seqDB search
MLKIKNFFLNIKRKKKIFIIFIIPGDLNINLTIKFMHILIKTGIHVIEIGIPFSDPVAEG
IFIQKSSERILKFGISIKNILNFIKKFRKINKFTPLIFMGYMNTYNLLNKKIYIKKINNL
LINNFIIVDFPIEEYLILKNIIKKKNINQIFLISSNTFLKRIKRILNLSKCFIYYVSLKG
TTGSKNIFFNKIKKKIKIVKNNTNLPLMIGFGINKKNIKNIINFSDGIIIGSNFLKFIQN
LKKKNIFINIINYIKNIKLNLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaataaaaaatttttttttaaatataaaaagaaaaaaaaaaatatttataata
tttattattccaggagatttaaatattaatctaacaattaaatttatgcatattttaata
aaaacaggaatacatgtaatagaaataggaatacctttttcagatccagtagcagaagga
atatttatacaaaaatcttctgaaagaatattaaaatttggtatttctattaaaaatatt
ttaaattttataaaaaaatttagaaaaataaataaatttactccattaatatttatggga
tatatgaatacttataatttattaaataaaaaaatatatattaaaaaaattaataattta
ttaattaataattttataattgtagattttcctatagaagaatatttaatattaaaaaat
ataattaagaaaaaaaatataaatcaaatatttttaatttcttcaaatacttttttaaaa
agaataaaaagaattttaaatttaagtaaatgttttatatattatgtttctttaaaagga
actacaggttctaaaaatattttttttaataaaataaaaaaaaaaattaaaatagtaaaa
aataatactaatttacctttaatgattggttttggtataaataaaaaaaatattaaaaat
attataaatttttctgatggtataattataggaagtaattttttaaaatttattcaaaat
ttaaaaaaaaaaaatatatttataaacattataaattatattaaaaatataaaattaaat
ttactttaa

DBGET integrated database retrieval system