KEGG   Ziziphus jujuba (Chinese jujube): 107407135Help
Entry
107407135         CDS       T04794                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00510  N-Glycan biosynthesis
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    107407135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:zju01003]
    107407135
Enzymes [BR:zju01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     107407135
Glycosyltransferases [BR:zju01003]
 Glycan extension
  N-Glycan
   107407135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 107407135
NCBI-ProteinID: XP_015869853
Position
Unknown
AA seq 443 aa AA seqDB search
MKLGFDSFYSIFSAMASNKKPRLKDKPALRRFLLVVSITLLGVFLLIIHMGKDSRSKSSF
ELDEDSSYKFNYSQFGEELNLPKQNTLSIELEKRNQMPPRNRDLYPRLAKDHTTIVLYVH
NRPRYLKVVVESLSRVVGISETLLIVSHDGYFEEMNEIIESIRFCQVKQIFAPYSPHVFL
DSFPGVSPKDCKDKDDAEKKHCNGTPDQYGNHRSPKIVSLKHHWWWMMNTVWDGLQETRE
DSNHILFIEEDHFIYPNAYRNLQMLTALKPKKCPDCYAANLAPCDVNSRGEGWDSLVAER
MGNVGYAFNRTVWRKIHKKAREFCFFDDYNWDITMWATVYPSFGGPVYSLRGPRTSAVHF
GKCGLHQGQGVKNACIDNGGVKIEVDKIDKVVNIKPEWEVRVFENQPGYKAGFKGWGGWG
DERDRQLCLNFARMYHLEDTASM
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgggttttgattctttttattctatttttagcgctatggcttccaacaagaaa
ccccgtttaaaagataagcctgcacttcgccgctttcttttagtagtttctattacgctg
ttgggggtttttttattgattattcacatgggaaaagattcaagatccaaatcttcattt
gaattggatgaggattcttcttataagtttaactattctcagtttggagaagaacttaac
ctccccaagcaaaatacattgtccattgaattggaaaaacgaaaccagatgccccctaga
aatagagatctatatccaagattagccaaggatcatacaaccatagttctatatgtacac
aaccgaccccgatatttgaaagtagttgtcgagagcctatcccgggtagttggaataagt
gaaactctgctgatagttagccatgatggttattttgaagaaatgaacgagattattgag
agtatcagattttgtcaagtcaagcagatatttgctccttactctccccatgtcttcctt
gatagctttcctggagtctcgccgaaggactgtaaagataaggatgatgcagaaaagaaa
cattgtaatgggactcctgatcagtatggaaaccacaggtctccaaagatcgtgtcattg
aagcatcattggtggtggatgatgaacactgtttgggatggattgcaagagacaagggaa
gactcgaatcatattcttttcattgaggaggaccactttatttatcccaatgcataccgt
aacttacagatgcttacggcattgaagcctaaaaaatgccctgattgctatgctgcaaat
ttagcaccttgtgatgtgaattcaagaggagaaggttgggatagtttggttgcagagaga
atgggaaacgtgggttatgcttttaatcggactgtttggaggaaaatccataaaaaggca
agagaattttgtttctttgatgattataactgggatataacgatgtgggcaacggtatat
ccctcctttggtggtcctgtttactcattgcgagggcctagaacaagtgcagttcacttt
ggaaagtgtggtttgcatcagggccaaggagtgaaaaatgcttgcattgacaatggtggt
gtaaaaatcgaagtggataagatagataaagttgtcaacatcaaaccagaatgggaggtc
cgggtctttgagaatcaaccagggtataaagctgggttcaagggctggggaggctgggga
gacgagagggaccgccaattgtgcttgaattttgctcgtatgtaccaccttgaagacact
gcttctatgtga

DBGET integrated database retrieval system