KEGG   Ziziphus jujuba (Chinese jujube): 107409492Help
Entry
107409492         CDS       T04794                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:zju00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107409492
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:zju03032]
    107409492
   03036 Chromosome and associated proteins [BR:zju03036]
    107409492
   03400 DNA repair and recombination proteins [BR:zju03400]
    107409492
Enzymes [BR:zju01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     107409492
DNA replication proteins [BR:zju03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107409492
Chromosome and associated proteins [BR:zju03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107409492
DNA repair and recombination proteins [BR:zju03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     107409492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg PADR1 WGR BRCT BRCT_2 SAP RTT107_BRCT_5
Motif
Other DBs
NCBI-GeneID: 107409492
NCBI-ProteinID: XP_015872416
Position
2
AA seq 798 aa AA seqDB search
MKVHETRSHSHAPVEEDKVMTRKQKAENKAHESEQTPKKAKAESDNNNGNPNGKSSSQEF
EDFCKAINEHLSVSQLREVLESNGLDSSGPDHVIIRKCQDLLFYGALEKCPVCNGNLEYN
GKRYSCTGSYSEWSSCTFTTKVPPRKDGPIKLTDSLLNSAVSDLIKRYGDASRRPQRDLG
GADKPFAAMTISLMGRLSRTHNYWKKEIEKHGGKVANSVIGVNCLVASSAERDRGGTSKL
AEAMERGISIVREEWLLDSIEKQEAQPLEAYEIVHDLTVDGKGVPWDKQDPSEEALESMS
AELKLYGKRGVYKDTKLQDQGGKIFEKDGILYNCAFYLCDLGRGLNHYCIMQLIMVSEHH
PHLYYKKGRVGDDPNAEERLEEWENVNNAVKEFVRLFEEVTGNEFEPWEREKKFQKKPSK
FYPIDMDDGVEVRHGGLGLRQLGIAATHCRLEPVVANFMKVLCSQEIYKYSLMEMGLDCP
DLPIGMVSKVHLRRCEEVLLEFIEKVKSMKEKGQKAEAVWSDFSQRWFTLMPSTRPFIFR
DYQEISDHAASALETIRDITVASHLIGDMSGSTIDDPLSDRYNKLGCSISPLEKNSDDYK
MILNYLDKTYEPVKLGDIEYGLSVDNIFVVESKACPSLDEIKKLPNKVLLWCGTRSSNLM
RHLXALQFGRAIVCSDAAAEAARYGFTAVDKPEGFLVLAVASLGDQVTEFTSPPEDTKSL
EEKKMGVKGLGRKRTEESEHFNWEGDVKVPCGRLVSSEHKDALLEYNEYAVYDPKQVSIR
FLVGVKLEEKDAVMETEE
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcatgaaacaaggtcacatagtcatgcaccagtcgaggaagacaaagtgatg
acgaggaagcagaaggcagagaacaaagctcacgaatcagagcaaactccaaagaaggcc
aaagccgaaagtgacaataataacggcaatccaaatggtaaatcttcttcacaagagttt
gaagatttttgtaaagcaatcaatgagcacctctctgtctcacaactgcgagaagtcttg
gaatctaatggactcgactcctccggccccgatcacgtcatcatcagaaaatgccaagac
ttgctgttttatggggcactagaaaaatgcccagtctgcaacggaaatttggagtacaat
gggaaacgctattcttgcactggatcttatagtgaatggtctagttgcaccttcaccaca
aaagttcctccaaggaaagatggacccatcaaattaactgattccctccttaactctgct
gtttcggatctgataaagagatatggagatgccagtcgccggcctcagagggatttaggt
ggtgctgataaaccttttgctgccatgaccatttctttaatgggccgtctctctcgaacc
cataattactggaaaaaagagatcgagaaacatggggggaaggttgccaactctgttatt
ggtgtaaattgcctggtggcctcgtctgctgaacgagaccgtggtggtacatctaaactt
gcagaagcaatggagaggggcatatctattgtaagagaagaatggttgttagacagcatt
gagaaacaagaagcccagcctcttgaagcctatgaaattgtccacgatcttactgtggat
ggcaaaggagttccatgggataaacaagatccttccgaggaggcgctggagtcaatgtca
gcagaactcaagctctatgggaaaagaggtgtctataaggataccaaattgcaggaccaa
ggtgggaagatctttgagaaagatggaatattgtacaactgtgccttttatctctgtgac
ttgggccgaggactaaatcattattgcataatgcaactgataatggtatcggagcaccat
ccccatttgtactacaagaaaggtagagttggcgatgaccctaatgcggaggaaaggctt
gaagaatgggagaatgtgaataatgctgtgaaggagtttgtgaggctctttgaggaggta
actgggaatgaatttgaaccgtgggaaagagagaagaagtttcagaagaagccgtccaag
ttctatcccatagacatggatgacggagtagaagtaagacatgggggccttggtcttcgg
cagctaggaattgctgctacacattgcagacttgagcctgtggtggcaaacttcatgaaa
gtcttgtgcagtcaggaaatttacaaatattcattgatggagatgggactagattgtcct
gatctgccaataggaatggtctccaaggtccacttaagaagatgtgaggaggtgctccta
gaatttatagagaaagttaagtcaatgaaggagaagggccaaaaggctgaagctgtgtgg
tccgattttagccaaagatggtttactcttatgccatcaactaggcctttcatctttagg
gattaccaagaaatttcagatcatgctgcatctgcattggaaactatccgagacataacg
gtggcttcacaccttataggagacatgagtggctctaccattgatgatccattatctgat
cgctacaacaaacttggctgctcaatctctcctctggagaagaattctgatgactataag
atgatcttgaattacctggacaaaacctatgagcctgtcaaactcggagatattgagtat
ggtctctctgttgataatattttcgttgttgaatccaaagcatgtccttctttggatgaa
ataaagaagttacccaacaaagtccttttatggtgcggtacacggagctcaaatctaatg
aggcacttanttgcattgcagtttggcagggcaattgtctgttctgatgctgctgcagag
gcagctaggtacgggtttactgctgtggacaaaccagaaggattcttggttcttgctgtt
gcttcactaggtgaccaagttaccgagttcacaagcccgccagaggataccaagtcactg
gaagagaagaaaatgggagtgaagggcttgggaaggaagagaacagaggaatcagaacat
ttcaattgggaaggtgatgttaaagttccatgcggtaggttggtatcctcagagcataaa
gatgctctacttgaatacaatgaatatgctgtgtatgacccaaaacaggtgagcataagg
tttttggtgggagtcaaactcgaagagaaggatgctgtgatggagacagaggaataa

DBGET integrated database retrieval system