KEGG   Ziziphus jujuba (Chinese jujube): 107409623Help
Entry
107409623         CDS       T04794                                 

Definition
(RefSeq) uncharacterized protein At4g19900
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00601  Glycosphingolipid biosynthesis - lacto and neolacto series
zju00603  Glycosphingolipid biosynthesis - globo and isoglobo series
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    107409623
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107409623
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:zju01003]
    107409623
Enzymes [BR:zju01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     107409623
Glycosyltransferases [BR:zju01003]
 Glycan extension
  P blood group
   107409623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 107409623
NCBI-ProteinID: XP_015872535
Position
Unknown
AA seq 474 aa AA seqDB search
MFDFDGPKLPRPLILFLHHLQELKRSVLDFLLCLPTSILAFTLLLLLVYNGFSVFCIHLP
FLAKTSPEPANFSPEYPAGKFPLLRLSSSYSSLRSLSSSSSSSSTSSSLSTSSSSFSSKL
YVVKEENPPPILKTHLQNHSFSVIRISTSSIRSHRRLKKHKRKLKILRSLPPQSSQFSTR
IREFFAAGNCKPRFFMTWISSLDFFGDRELFAIESLFKSHPNACLVMVSNSMDSKKGNQI
LKPFSDTGFKVMTISPDFDFIFKNTHAGAWFCRLREGNVDPGEVALGQNLSNLLRLALLY
KFGGIYVDTDIIILKSFSKLRNVIGAQTVDIETGNWSRLNNAVLIFDKNHPLLFKFIQEF
ALTFNGNKWGHNGPYLVSRVVSRVSGRTGYNFTILPPSAYYPVDWTRIRSLFQGPRDEIH
SNWLISKLKQIRNESFAVHLWNRQSRSLEIEKGSIIHHILSDCCIFCNHSSSSL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattttgatggtcccaaacttcctcgccctctcattctctttcttcaccatttg
caggaactaaaaagatctgtgcttgattttctcctctgcttgcctacttctattttggct
tttactcttcttctccttttggtctacaatggcttctctgtcttttgcattcaccttcct
tttcttgccaaaacttcaccagaacccgccaatttttctccggaatatcccgctggaaaa
tttccgctactcaggttgtcctcttcttattcctcattgcgttcactgtcttcttcttct
tcttcttcttctacttcttcttctctttctacgtcttcttcttctttctcttcaaagcta
tacgtagtgaaagaagaaaacccacctccgattttgaaaacccatttgcaaaatcacagc
ttttcagtgattcgcatttccacttcttcgattcgaagccataggcggcttaagaagcac
aaaaggaagctgaaaatcctccgctccctaccaccacaatcgagtcagttctcaacaaga
ataagagagttctttgctgcaggaaattgtaagcctcgcttcttcatgacttggatttct
tctttggatttttttggtgatagggaactgtttgccatagagagcttgttcaagtcccac
ccaaatgcttgtttggtcatggtctcaaactccatggattccaagaaaggaaatcaaatc
ctgaagcccttttctgatacgggattcaaggtaatgacaatttctccagattttgatttc
atattcaagaacactcatgctggggcatggttttgtagattaagagaaggtaatgtggat
ccaggtgaggttgctttgggtcaaaacctctctaatctgcttaggctggctttgttgtat
aaatttggcggtatttacgtagacacagatattataatccttaagagcttctcaaaattg
agaaatgtgattggtgctcaaactgtcgatattgaaactgggaattggagcagattgaat
aatgcagttctgatttttgataagaaccatccattgctcttcaaattcatccaagaattt
gcactcacttttaatgggaacaagtggggtcacaatgggccttacttggtttcaagggtg
gtctccagggttagtggaagaacaggatataatttcactattttgccaccatctgcctat
tatccagtggattggacaagaattcgaagcctttttcaaggtcctagagatgaaattcac
tccaactggttgatttcgaagctgaaacagattaggaacgaaagctttgctgttcatttg
tggaacagacagagtagaagtttagagattgaaaagggaagcattattcatcatattctt
tcagattgttgtatcttctgcaatcattcatcttcaagcttgtga

DBGET integrated database retrieval system