KEGG   Ziziphus jujuba (Chinese jujube): 107411076Help
Entry
107411076         CDS       T04794                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju03040  Spliceosome
zju04141  Protein processing in endoplasmic reticulum
zju04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:zju00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107411076
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107411076
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107411076
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:zju01009]
    107411076
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:zju03041]
    107411076
   03009 Ribosome biogenesis [BR:zju03009]
    107411076
   03110 Chaperones and folding catalysts [BR:zju03110]
    107411076
   04131 Membrane trafficking [BR:zju04131]
    107411076
   03051 Proteasome [BR:zju03051]
    107411076
   03029 Mitochondrial biogenesis [BR:zju03029]
    107411076
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zju04147]
    107411076
Protein phosphatases and associated proteins [BR:zju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107411076
Spliceosome [BR:zju03041]
 Complex B
  Other components
   Prp19 complex
    107411076
 Complex C
   Prp19-CDC5 complex
    107411076
Ribosome biogenesis [BR:zju03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107411076
Chaperones and folding catalysts [BR:zju03110]
 Heat shock proteins
  HSP70 / DNAK
   107411076
Membrane trafficking [BR:zju04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107411076
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107411076
Proteasome [BR:zju03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107411076
Mitochondrial biogenesis [BR:zju03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107411076
Exosome [BR:zju04147]
 Exosomal proteins
  Proteins found in most exosomes
   107411076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 107411076
NCBI-ProteinID: XP_015874072
Position
2
AA seq 650 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPTNTVFDAKRLIGRRFSDVSVQTDMKLWPFKVIAGPGDKPMIVVTYKGEEKQFSA
EEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKAGSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRSLRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSKVHDVVLVGGSTRIPKVQQLLQNFF
NGKELCKSINPDEAVAYGASVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
NVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEELKR
KVEAKNTLENYAYNMRNTIKDEKIGSKLPAADKKKIEDAIEQTIQWLDGNQLAEVDEFED
KLKELEGICNPIIAKMYQGGAGDAAMDDDGPAAAAGGSGSGSGPKIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaaggtgagggtccagcaattggaatcgacttggggacgacgtactcgtgc
gtcggtgtttggcaacatgatagggttgagatcatagccaatgatcaaggaaacaggacg
actccgtcttacgtggctttcaccgatacggagcgtttgatcggtgatgcggctaagaat
caggtcgccatgaatcctaccaatactgttttcgatgccaaacgtttaattggtaggcga
ttcagtgatgtatctgtgcaaactgacatgaaattatggccgttcaaggtgattgctggc
cctggcgacaagccaatgattgtagtcacctacaaaggtgaggagaagcaattttctgcg
gaagagatctcctcaatggttcttattaaaatgagggagattgcagaggcttatcttggc
gcaactatcaagaatgccgttgtcactgtgcccgcttacttcaacgattcacagcgtcaa
gcaacaaaggatgctggtgttattgctggcctcaatgtgatgcggatcatcaatgagccc
actgctgctgccattgcatatgggcttgacaagaaagccggtagtagtggtgaaaagaat
gtgttgattttcgaccttggtggtggcacatttgatgtctctctcctcaccatcgaagag
ggtatcttcgaagtgaaggctacagctggtgatactcatttaggtggtgaagattttgat
aacaggatggtgaaccatttcgttcaggagttcaagagaaagaacaagaaggatattagc
gggaatcctagatcattgaggaggttgaggactgcttgtgagagggccaagaggactctc
tcatccactgctcaaaccaccattgaaattgattctttatacgagggtattgatttctac
tctaccattactagggcaagattcgaggagcttaacatggatctgttcaggaagtgtatg
gagcctgtggagaagtgtttgagggatgctaagatggacaagagcaaagtacatgatgtg
gtcctagttggtggatctactaggattcccaaggttcaacaattgttgcagaactttttc
aatggaaaggaactttgcaagagcattaaccctgacgaggctgttgcatatggtgcctct
gttcaggccgcaatccttagcggtgagggtaatgagaaggtgcaggaccttctgttgctg
gatgtcactccattgtctcttggtctggaaactgcaggaggagtaatgaccgtgttgatt
cccagaaacactaccatcccaacaaagaaggagcaggtgttctctacgtactctgataat
caacccggcgtactgatccaggtgtacgagggtgaaaggacgaggactagggataacaac
ttgcttggcaaatttgagctctctggaattcctcctgctcctaggggagttccacaaatc
aatgtctgtttcgacattgacgccaatggcatcttgaatgtctctgccgaggacaaaacc
accggacagaaaaacaaaattacaatcaccaacgacaagggcaggctctccaaggaggag
attgagaaaatggtacaagaagcagaaaagtacaaggccgaggacgaggagcttaagcgg
aaggtcgaggcaaagaatactctggaaaactacgcttacaacatgaggaacacaatcaaa
gatgaaaaaattggttcaaaactccctgcggctgacaagaagaagattgaagatgcaatt
gagcaaaccatccagtggctcgacggcaaccagcttgcagaggtggatgagtttgaggac
aagctcaaggagttggagggcatctgcaacccaattattgccaaaatgtaccaaggtgga
gctggtgatgctgccatggatgatgatggtcctgctgctgctgctggtggtagtggaagt
ggctctggacccaagattgaggaggtggattaa

DBGET integrated database retrieval system