KEGG   Ziziphus jujuba (Chinese jujube): 107412222Help
Entry
107412222         CDS       T04794                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:zju01001]
    107412222
   01009 Protein phosphatases and associated proteins [BR:zju01009]
    107412222
Enzymes [BR:zju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107412222
Protein kinases [BR:zju01001]
 Serine/threonine kinases: Other
  Wnk family
   107412222
Protein phosphatases and associated proteins [BR:zju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107412222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal TPKR_C2
Motif
Other DBs
NCBI-GeneID: 107412222
NCBI-ProteinID: XP_015875430
Position
2
AA seq 750 aa AA seqDB search
MNGLTDLEPDCSEFVEVDPTGRYGRYNEILGKGASKIVYKAFDEYEGIEVAWNQVKLYDF
LQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDTANRNINFVTEMFTSGTLRQYRLKHK
RVNIRAVKHWCRQILRGLHYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRK
SHAAHCVGTPEFMAPEVYEEAYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVVS
GKKPDALYRVKDPEVRQFVEKCLATVSLRLSARQLLNDPFLQIDDCEYDLRPVDCGRDLD
DLGPHIRQPLFDLHRSGSSFSNGFSNGYSNGFGFEAQSEWGYQPVEIEPCGIELFEHHDD
EHCEDTGISIKGKRREDGGIFLRLRISDKEGRIRNIYFPFDIEMDTALSVATEMVAELDI
TDQDVTGIAGMIDGEIASLVPEWQPGPGILETPHFANQNFCLNCASNHTSSGSFMEFLSK
NPGAKNLQVLQCCRHGCASMHGRFEEITYQADESEHHATEVAPKVSSQLNFLHYQEIWGL
HESRELSSVGSGRSHSDEEYEKIDHSIDHLKDEKVNKLDDNNKSNGINSLQNLSGSRSLS
SMASLSHDLSDTYEKDKRQELRWLKAKYQMELRELRDQQLGCVPNSSNDGSKDEILENGF
MSSLLLNSLQKGNGVLLQSSADDPQFSLNCRDSVYKSSNLEIKRAQHSKALKSPNANAED
MVTARSFYTGSLLPNSLHRTVSLPVDAVDI
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtctaaccgatcttgaaccagattgctctgagtttgttgaagttgatccgact
ggcagatatggcagatacaatgaaatccttggcaaaggagcttcaaagatagtttacaaa
gcatttgatgagtatgaagggattgaagttgcttggaaccaggtcaagctttatgatttc
ctgcaaagccctgaagatcttgagaggctttactgtgaaattcatctcctaaagacattg
aagcataagaacattatgaagttctacacttcttgggttgatactgcaaataggaacatc
aattttgtgactgaaatgttcacttctgggactctcagacagtacaggctaaagcacaag
agagttaacatccgagctgtgaagcactggtgtaggcagatcttgagagggcttcactac
ctgcatagccatgaccctcctgtgatccacagagatcttaaatgtgacaatatctttgtc
aatgggaatcaaggagaagtgaagattggtgatcttggtctagcagcaatcctcagaaaa
tctcatgccgctcactgcgttgggacgccagagtttatggctcccgaagtctacgaagag
gcatacaatgaattagttgacatttattcatttgggatgtgcattttggaaatggtcact
tttgaatatccatatagtgaatgcactcatcctgctcagatctacaagaaagttgtttct
gggaaaaaaccagatgctttgtacagagttaaggatccagaagtgagacaatttgttgag
aaatgcttggcaactgtctctttaaggctctctgcgagacaacttttgaacgatcctttt
ctccaaattgatgattgtgaatatgatttgagaccagtcgattgcgggagagacttagat
gacctgggtccacatataaggcagcctttatttgatcttcatcgaagtggtagttccttt
agcaatggctttagcaatggatactcaaatggttttggctttgaagcccaaagtgaatgg
ggatatcaacctgttgagattgaaccatgtggaatcgaacttttcgagcaccatgatgat
gaacattgtgaagacaccggcataagtattaaagggaagaggagagaagatggtggcatc
tttttgaggcttagaatttcagataaagaaggccgtataagaaacatctatttcccattt
gacattgagatggatacagcattgagtgttgcaactgaaatggttgcagaactagatatt
actgatcaggatgttacaggaatagcgggcatgattgatggggaaattgcttccttggtt
ccggaatggcaaccaggacctggtatattggaaacaccgcactttgctaatcaaaacttc
tgtctcaattgtgcttccaaccatacctccagtggttccttcatggagtttctttcgaag
aaccctggtgccaagaacttgcaggttcttcaatgttgtagacatggatgtgcgtcgatg
catggtcgttttgaggagattacatatcaagccgatgagtctgagcatcatgctacggaa
gttgcacctaaagtttcaagccagttgaacttcctgcattaccaagaaatttggggactg
catgaaagtcgagagttgagttcagtaggctctggacggagccattctgatgaagaatat
gaaaaaattgatcactctatagaccatctgaaggatgagaaggttaataaattggatgac
aataataagtccaatggaataaattccttacagaacttatctggttcacgatctttatcc
tcgatggcttcactctctcatgacctctcagacacatatgagaaggataagcgacaggaa
ctgagatggctcaaagcaaagtatcagatggaactgagggagcttagagatcaacaattg
ggatgtgtcccaaattcttccaatgatggaagcaaagatgaaatattagaaaatgggttc
atgtcatctttgctattaaattcattacaaaaaggcaatggcgttctcttgcaatcttct
gctgatgacccacaatttagtttgaattgccgtgatagtgtctataagagttctaatttg
gaaatcaaaagggctcaacatagcaaagccttgaaatctcctaatgctaatgcagaggat
atggtgactgccaggagtttctacactggttcactgcttccaaactctcttcacagaaca
gtttccctcccagttgatgctgttgatatataa

DBGET integrated database retrieval system