KEGG   Ziziphus jujuba (Chinese jujube): 107413420Help
Entry
107413420         CDS       T04794                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP20-1
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Brite
KEGG Orthology (KO) [BR:zju00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107413420
Enzymes [BR:zju01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     107413420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C DUF5401
Motif
Other DBs
NCBI-GeneID: 107413420
NCBI-ProteinID: XP_015876852
Position
3
AA seq 188 aa AA seqDB search
MGDSVDLTGDGGVVKTVLRHAKADAVSPTEDLPLVDVHYEGILAENGEIFDTTHEDNTVF
SFELGKGTVVKAWDIAVRTMKVGEIAKITCKPEYAYGSAGSPPDIPPDATLIFEVELLSC
NPRKGSSLGSVSEERARLEELKKQREIAATAKEEEKKKREEAKAAAAARIQAKLESKKSQ
GKGKGKGK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattctgttgatttgactggagatggaggtgtcgtcaagacagttctaaggcat
gccaaagcagatgcagtttctccaactgaagatcttcctcttgttgatgttcattatgaa
ggcattcttgctgaaaatggtgaaatctttgatactacacatgaggataatactgttttc
tcatttgagctcggaaagggcacggtagtcaaagcatgggacattgcagtgagaaccatg
aaggttggggagattgcaaaaatcacttgtaagcctgagtatgcctatggaagtgctggt
tccccaccagatattccaccagatgcaacgcttatttttgaggtggaattactttcctgc
aatccacgtaagggatcaagcctcggtagtgtttcagaggagagggctagacttgaagag
ctgaagaagcagagggagattgctgccactgccaaagaggaagaaaagaagaagagagaa
gaagccaaagccgcggctgcggctcgcattcaagcaaagttggaatccaagaaaagtcaa
gggaagggaaaaggcaaaggaaagtaa

DBGET integrated database retrieval system