KEGG   Ziziphus jujuba (Chinese jujube): 107413619Help
Entry
107413619         CDS       T04794                                 

Definition
(RefSeq) protein IN2-1 homolog B-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00480  Glutathione metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107413619
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:zju02000]
    107413619
Enzymes [BR:zju01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107413619
Transporters [BR:zju02000]
 Other transporters
  Pores ion channels [TC:1]
   107413619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C GST_N GST_C_5 GST_C_3
Motif
Other DBs
NCBI-GeneID: 107413619
NCBI-ProteinID: XP_015877107
Position
3
AA seq 300 aa AA seqDB search
MSYSSFTTASSSSPLTYPRKFSDSISFSNKFVLIRFPKTHILSSTEIQQKPGFGRSKAAH
FTTMATTGSKQEVLPPAFTSTSDPPPVFDGNTRLYISYQCPYAQRVWITRNVKGLQEKIQ
LVPIDLKDRPSWYKEKVYPDNKVPSLEHNNKVIGESLDLIKYIDSQFKGPSLFPDDPARI
EFAEELFSQSGSVHKSVTSSFKGEVEEAGAAFDYIETALSKFEDGPFFLGQFSLVDIAYA
PFIERYQLFLLDVKKYDITEGRPKLKAWIEEINKIEGYRQTRNDPKELVESYKERFLVQV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagctacagcagcttcactactgctagctcttcttcacccctaacctatccacgaaaa
ttttcagattcaatctctttctccaacaagtttgtactgattagattccctaaaacccat
atcttatcttctactgagattcaacaaaagcctggttttggaagatctaaagctgctcac
tttacaacaatggcaactactggaagtaagcaagaggttcttccaccagctttcacttct
acttcagacccacccccagtcttcgatggaaatacaaggttgtatatatcgtaccaatgc
ccatatgcgcaacgtgtgtggattacccggaatgttaagggattgcaggaaaagatacaa
ttggttcctattgatttgaaagacaggccttcatggtacaaagagaaagtttacccagat
aacaaggtgccatcattagaacacaataacaaagttataggagagagtcttgacttgatt
aaatacattgacagtcaattcaaagggccttcactttttcctgatgatcctgcaaggata
gaatttgcagaagagttattctcgcaatctggctcagtccataaatccgtcacttcttca
tttaaaggagaagtagaggaagccggtgctgcatttgattacattgaaacagctctctct
aaatttgaagatggacctttctttcttggccagtttagtttggtggatatagcttatgct
ccatttattgaaagatatcaacttttcttattggatgtaaagaaatatgacatcactgaa
ggcaggcctaaactgaaagcatggattgaggagataaacaaaattgaaggttacagacaa
actcgaaatgatccaaaggaacttgttgaaagctacaaggaacgcttcttggttcaggtc
tga

DBGET integrated database retrieval system