KEGG   Ziziphus jujuba (Chinese jujube): 107413891Help
Entry
107413891         CDS       T04794                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00010  Glycolysis / Gluconeogenesis
zju00562  Inositol phosphate metabolism
zju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107413891
   00562 Inositol phosphate metabolism
    107413891
Enzymes [BR:zju01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107413891
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107413891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107413891
NCBI-ProteinID: XP_015877432
Position
3
AA seq 491 aa AA seqDB search
MVREHITQSSSEFMTCGILDMDGLKTTLMLFSVLDYSQVQHGFYFFHLYGVVKDVADNSF
VASEIPNGCTPIHLNLVSRHGTRSPTKKRIRELDNLAAHLELLLKDAEEQKLSLQKIPTW
LRNWKSPWKGKVKGGELISKGEDELYDLGTRIREKFSDLFNDEYHPDVYTMKATQVPRAS
ASAVAFGMGLFSGRGSLGPGHHRAFAVSTESRASDIFLRFHDCCENYKDFRKRQEPFVHK
LKEPFFDEITSALVRRYELNFTRQDTSSLWFLCKQEASLLDITDQACGLFSPSEVALLEW
TDDLEVFILKGYGKSLNYRMGVPLLEDVVQSMEQAIQAKEENHPPGSYEKARLRFAHAET
VVPFSCLLGLFLEKSEFQQIQREQPLQLPPKPLQKRKWRGSTVAPFAGNNMLVLYSCPSN
ANTSSNYFVQVLHNEHPIPMPGCDGSDFCPFEDFKERIVAPHLKHDYDTVCNANVETEVQ
MPATTTTSSSF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtgaacacattacacagtcgagtagcgaattcatgacctgtggcatattggac
atggatggtctcaaaactacccttatgcttttctctgttcttgattactcccaagtccaa
cacggcttctatttcttccacctatacggtgtcgtcaaggatgttgctgacaattccttt
gtagcttcggaaattccaaatggatgtactcctatccacctcaaccttgtgtcaaggcat
ggaactcgttctcctactaagaaacggattagggagttagacaacttggcagctcatctg
gaactacttttgaaagatgcagaagaacaaaaattgtctttacagaaaattcctacctgg
ttacgcaattggaaatctccttggaaaggaaaagtgaagggtggagaattgatcagcaaa
ggagaggacgaactgtatgatctcgggaccaggattagagaaaaattttcagatttattt
aatgatgaataccacccagatgtgtatacaatgaaagcaactcaggttcctcgggcatcg
gctagtgccgtagcatttggcatggggttgttttctgggagaggaagtctaggaccaggg
caccatcgagcttttgctgtaagcactgaaagccgtgcaagtgatatattcctgcggttt
catgattgttgtgaaaattataaggacttcaggaaacgtcaggagccttttgttcataag
cttaaggaacctttctttgatgagatcacctctgctctagtgcggcgctatgagttgaat
tttacaaggcaggacacctcttctctctggtttctgtgcaaacaggaagcatccttgttg
gatataactgatcaagcttgtggtctttttagtccctctgaggttgctttgctggagtgg
acagatgatttggaagtgtttatattgaagggttatggtaaatcattgaattatcgaatg
ggggtgccattacttgaagatgttgtgcaatccatggagcaagctattcaggccaaggaa
gagaaccatcctcctggaagttatgaaaaggcaaggttaaggtttgctcatgcagaaact
gtggttccattttcatgtctgctcggactttttcttgaaaaatctgaatttcaacaaata
cagagggaacaacccttgcaacttcctcctaagccactccaaaaaagaaaatggagggga
agcactgtggcaccttttgcggggaataacatgctggttttatacagctgtccatctaat
gctaacacttcaagcaattactttgtgcaagtactgcataatgagcatcccattccaatg
ccaggttgtgatggttctgatttctgcccgtttgaagattttaaggaaagaatagttgct
cctcatttgaagcatgattatgatacagtttgcaatgcaaatgtggaaacagaagtgcag
atgcctgcaaccactacgaccagctcttccttctag

DBGET integrated database retrieval system