KEGG   Ziziphus jujuba (Chinese jujube): 107416944Help
Entry
107416944         CDS       T04794                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00350  Tyrosine metabolism
zju00360  Phenylalanine metabolism
zju00380  Tryptophan metabolism
zju00950  Isoquinoline alkaloid biosynthesis
zju00965  Betalain biosynthesis
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107416944
   00360 Phenylalanine metabolism
    107416944
   00380 Tryptophan metabolism
    107416944
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    107416944
   00950 Isoquinoline alkaloid biosynthesis
    107416944
   00965 Betalain biosynthesis
    107416944
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zju04147]
    107416944
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107416944
    4.1.1.105  L-tryptophan decarboxylase
     107416944
Exosome [BR:zju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107416944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Aminotran_5 baeRF_family7 baeRF_family3 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107416944
NCBI-ProteinID: XP_015880976
Position
4
AA seq 494 aa AA seqDB search
MGSLDLNYDDESFSSPRQFKPLDPEEFRKQAHQMVDFIVDYYQKIESYPVLSQVQPGYLR
TRIPQTAPYSPESLETIFTDIASDIIPGMTHWLSPNFFAFFPATVSTAAFLGEMLSTCFN
SVGFNWLASPAATELEMVVMDWLANMLKLPKSFMFSGTGGGVIQSTTSESVLVTLIAARD
RALDKIGAEKMKKLVVYGSDQTHSMFVKASKLAGIHPSNIRSIPTNLHNEFSLCPAVLRN
VVEADVAEGLVPLYLCATVGTTSTTAIDPVQPLAEVANDHGMWIHVDAAYAGSACICPEF
RHYLNGVERVDSLSLSPHKWLLSYLDCCCLWVKRPGVLVKALSTNPEYLRNKPSDSDAVV
DFKDWQVGTGRKFKSLRLWMVLRSCGIANLQNHIRSDIRMAKMFERLVKLDPRFEIVTPR
RFALVCFRLNPFPSGNAERTELMNRKLLEWINSSGRIYVSHTIVGGVYMLRFAIGATLTE
ERHVVAAWGVTRNG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcctagatttgaactacgatgacgagtctttctcatctccccgccagttcaaa
cccttagaccccgaagaattccgcaaacaagcccatcaaatggtcgacttcattgttgat
tactaccaaaaaatagaatcctacccagttctcagccaagtccaacctggatatctccgt
acccgcatcccacaaaccgcaccgtatagtcccgaatcattggaaaccattttcaccgac
attgccagtgatataatccctgggatgactcactggttaagcccaaactttttcgcattc
tttcctgccaccgtcagcacagctgcttttcttggagaaatgctgtctacttgttttaac
tcggtgggattcaattggttggcttctccggcagccaccgagctcgagatggtcgtcatg
gactggcttgctaacatgctcaaacttcccaaatctttcatgttttcgggcaccggaggt
ggtgtcatccagagcaccaccagcgaatcagtcctcgtcacgctcattgccgccagagac
cgtgctctcgataaaattggagccgagaaaatgaagaagctcgtcgtctacggctccgac
caaacccattccatgtttgtcaaggcctccaagctagccggtatacacccttccaacata
aggtccatccccacaaacctccataacgagttttcattatgcccggctgtactccgtaat
gttgtggaagctgacgtggcagagggattggtcccactctatctctgtgccaccgtggga
accacttccaccacagccatcgaccccgtgcagccacttgccgaagtggcaaacgatcac
ggcatgtggattcacgtggatgcggcttacgctggaagcgcttgtatctgtcccgagttc
aggcattacttaaacggggtcgagcgggttgactcactgagtctgagcccgcataaatgg
ctgctcagttacttggattgttgctgtttgtgggtgaagcggccgggtgttttggtcaaa
gcgctgagcacaaatccggagtatttgagaaacaaacccagcgactcagacgcagtggtg
gatttcaaagactggcaagtgggtacgggtcggaaattcaagtcgctcagactgtggatg
gtactgcggagctgcggcattgcgaaccttcagaaccacattcggtcggatatccgaatg
gccaaaatgttcgagaggttggtgaaattggaccccaggttcgagatcgtgactcccaga
cggtttgcgttggtttgttttcgattaaacccgtttccatcagggaacgccgaacgcacg
gagttaatgaataggaaactactagaatggataaactcgagcggtcggatttatgtatcg
cacacaatagttggtggggtttatatgttgaggtttgcaattggagccacgcttactgaa
gagcggcacgtggttgcggcgtggggggtgaccaggaatggg

DBGET integrated database retrieval system