KEGG   Ziziphus jujuba (Chinese jujube): 107417353Help
Entry
107417353         CDS       T04794                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00630  Glyoxylate and dicarboxylate metabolism
zju00710  Carbon fixation in photosynthetic organisms
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
zju01200  Carbon metabolism
Module
zju_M00165  Reductive pentose phosphate cycle (Calvin cycle)
zju_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
zju_M00532  Photorespiration
zju_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107417353
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107417353
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107417353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 107417353
NCBI-ProteinID: XP_015881453
Position
4
AA seq 182 aa AA seqDB search
MASSIMSSATVATLNRSTPTQASIVAPFTGLKSSSAFPVTKKANNDITTHANNGGRVQCM
QVWPTTGKKKFETLSYLPPLSREQLGKEVDYLLRSGWVPCLEFELQHGFVYRENHRSPGY
YDGRYWTMWKLPMFGCNDSAQVLGELDEAIKAYPNAFVRIIGFDNVRQVQCISFIAYKPP
GF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccattatgtcatcggccactgttgccacacttaaccgttccactccgaca
caagccagcatagtggctcctttcaccggtctcaaatcgtcctccgctttccccgtcacc
aagaaggccaacaacgacattaccactcacgccaacaatggcggaagagtacaatgcatg
caggtgtggccaacaactggaaagaagaagttcgagaccctatcctaccttccacctcta
tccagagaacaattgggcaaggaagttgactaccttctcaggtcgggatgggttccctgc
ttggaattcgagttgcagcacggatttgtataccgtgagaaccacagatctccagggtac
tatgatggaaggtactggaccatgtggaaacttcctatgtttggatgcaatgactcagca
caagtgttgggcgagctggacgaggcaataaaggcataccccaacgccttcgtccgaatc
attgggttcgacaacgttcgtcaagtgcaatgcatcagtttcattgcttacaagcctcct
ggtttctaa

DBGET integrated database retrieval system