KEGG   Ziziphus jujuba (Chinese jujube): 107417844Help
Entry
107417844         CDS       T04794                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
zju00020  Citrate cycle (TCA cycle)
zju00640  Propanoate metabolism
zju01100  Metabolic pathways
zju01110  Biosynthesis of secondary metabolites
zju01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107417844
   00640 Propanoate metabolism
    107417844
Enzymes [BR:zju01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107417844
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107417844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 107417844
NCBI-ProteinID: XP_015881982
Position
5
AA seq 349 aa AA seqDB search
MGRQAVAKLIGSIAKRNSLYSSPSSSSSSSSSILSSGSAAQSRRHYAAAPPPPPAVFVDK
NTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKAN
ASVIYVPPPFAAKAILEAVEAELDLVVCITEGIPQHDMVKVKAALNKQSKTRLIGPNCPG
IIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGT
NFVDCIERFLVDPQTEGIILIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRM
GHAGAIVSGGKGTAQGKIQTLREAGVTVVESPAKIGTAILDVFKQKGLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgccaagccgtcgcgaagctgatcggctcgatcgcgaagcgcaattctttatat
tcttccccttcttcttcatcgtcttcttcttcttccatactttcgtctggttcggctgct
cagagtcgccggcattatgcggcggctcctccaccaccgccggcggtgttcgttgacaag
aacactcgcgtcatttgccaaggaattacgggaaagaatggcacttttcacaccgagcaa
gccattgaatacggcaccaaaatggttggtggtgtaacgccaaagaagggtggaacagag
cacttgggacttcctgttttcaacaccgttgctgaagcaaaagctgaaacaaaggcaaat
gcctcagtcatttatgttcccccaccattcgctgctaaagccattctagaggcagtagaa
gctgagttggatcttgttgtgtgtatcactgaggggatcccacaacatgatatggtaaaa
gtgaaagctgctcttaacaagcaatctaaaactcggctgattgggccaaattgtcctggt
attatcaagcctggagaatgcaaaattggaattatgcctggctacatccataaacctggt
cgtgtgggaattgtttctcgttctgggacgttgacctatgaagcagttttccaaactact
gctgtcggacttggacaatctacctgtgttggtattgggggggatccttttaacgggaca
aactttgttgactgcattgagagattcctagttgatcctcaaacagaaggaatcattctt
ataggtgagataggtggcactgcagaagaagatgctgctgcattgataaaggaaagtgga
actgagaagcctgttgttgcatttattgctggcctaactgctccccctggtcgtcgaatg
ggtcatgctggagctattgtgtcaggcggcaaaggtacagcgcaagggaaaatccaaacc
ctaagggaagctggggtaacagtggtggagtctccggcaaaaattgggaccgccattctt
gatgtattcaagcagaagggccttgtttaa

DBGET integrated database retrieval system